Align D-mannonate dehydratase; ManD; EC 4.2.1.8 (characterized)
to candidate AO356_20290 AO356_20290 galactonate dehydratase
Query= SwissProt::Q1NAJ2 (403 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_20290 Length = 382 Score = 194 bits (492), Expect = 5e-54 Identities = 125/395 (31%), Positives = 200/395 (50%), Gaps = 42/395 (10%) Query: 21 LKIMTDEGVYGLGDATLNGRELAVASYLTDHVIPCLIGRDAHRIEDLWQYLYKGAYWRRG 80 LK+ TDEGV G G+ + GR VA+ + + + LIG+D IED+W LY+G ++R G Sbjct: 18 LKVETDEGVTGWGEPVVEGRAHTVAAAV-EELSDYLIGKDPRNIEDIWTVLYRGGFYRGG 76 Query: 81 PVTMTAIAAVDMALWDIKGKIAGLPVYQLLGGASREGVMVYGHANGTTIEDTVKVALDYQ 140 + M+A+A +D ALWDIKGK G+ V LLGG R+ + VY G DT + A + Sbjct: 77 AIHMSALAGIDQALWDIKGKALGVSVSDLLGGQVRDKIRVYSWIGGDRPADTARAAKEAV 136 Query: 141 AQGYKAIRLQCGVPGMASTYGVSKDKYFYEPADADLPTENIWNTSKYLRIVPELFKAARE 200 A+G+ A+++ G + ++ DL N+ A R+ Sbjct: 137 ARGFTAVKMN----------GTEELQFLDTFEKVDLALANV--------------AAVRD 172 Query: 201 SLGWDVHLLHDIHHRLTPIEAGRLGQDLEPYRPFWLEDATPAENQEAFRLIRQHTTAPLA 260 ++G +V + D H R+ A L ++L+PY+ ++E+ +EN EA + + T+ P+A Sbjct: 173 AVGPNVGIGVDFHGRVHKPMAKVLMKELDPYKLMFIEEPVLSENYEALKELAPLTSTPIA 232 Query: 261 VGEIFNSIWDAKDLIQNQLIDYIRATVVHAGGITHLRRIAALADLYQIRTGCHGATDLSP 320 +GE S WD K ++ +D I+ HAGGIT R+IA +A+ Y + H L P Sbjct: 233 LGERLFSRWDFKRVLSEGYVDIIQPDASHAGGITETRKIANMAEAYDVALALH--CPLGP 290 Query: 321 VCMAAALHFDLSVPNFGIQEYMR--HMPETDAVF-----PHAYTFADGMMHPGDQPGLGV 373 + +AA L D N IQE H E++ + P + + G + + PGLG+ Sbjct: 291 IALAACLQLDAVCYNAFIQEQSLGIHYNESNDLLDYIKDPQVFDYDKGFVKIPNGPGLGI 350 Query: 374 DIDED-----LAAGYEYKRAFLPVNRLEDGTMFNW 403 +I+E+ A G+ ++ P+ R DG+ W Sbjct: 351 EINEEYVIERAAIGHRWRN---PIWRHADGSFAEW 382 Lambda K H 0.322 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 382 Length adjustment: 31 Effective length of query: 372 Effective length of database: 351 Effective search space: 130572 Effective search space used: 130572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory