Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO356_29020 AO356_29020 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_29020 Length = 256 Score = 183 bits (465), Expect = 3e-51 Identities = 108/260 (41%), Positives = 154/260 (59%), Gaps = 13/260 (5%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 LL+V ++S+ F G+ AI+D SF K G+I ALIGPNGAGK+++ N + G Y+ G + F Sbjct: 4 LLEVRNVSLSFQGVKAISDLSFSVKLGEICALIGPNGAGKSSLLNILNGVYRADAGQLFF 63 Query: 74 NQKSGKQYLLERLPDFRITKEAR--VARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131 E L K AR + RTFQN LF ++V++NLL ++ + + Sbjct: 64 --------AAEPLRRPHPLKAARLGIGRTFQNNALFKKMSVVDNLLTGL-SRFQRT--FF 112 Query: 132 ILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPE 191 + +G+ +REA E A LE +L D G L YG Q+R+E+ RA+ P Sbjct: 113 LEQALGLPRARREARAFAERAERVLEFLELQAWRDVAVGSLAYGLQKRVELGRALIAQPT 172 Query: 192 LLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKI 251 LL LDEP AG+N E ++ + I + GT+++LIEHD+ VVM +S HVVVL+YG+K+ Sbjct: 173 LLLLDEPMAGMNAEEKQDMSRFIADINRDLGTTVILIEHDIQVVMGLSSHVVVLDYGRKV 232 Query: 252 SDGTPDHVKNDPRVIAAYLG 271 DGTP V+ +P VIAAYLG Sbjct: 233 GDGTPAEVQANPDVIAAYLG 252 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 256 Length adjustment: 25 Effective length of query: 267 Effective length of database: 231 Effective search space: 61677 Effective search space used: 61677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory