Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate AO356_28780 AO356_28780 host specificity protein
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28780 Length = 296 Score = 164 bits (414), Expect = 3e-45 Identities = 107/274 (39%), Positives = 150/274 (54%), Gaps = 14/274 (5%) Query: 8 SALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTPEARV--LV 65 S LFVP RPER KA+ + D +I+DLEDAV K ARA + + P + Sbjct: 15 SYLFVPGNRPERFAKAVDATPDAIILDLEDAVHPDSKAAARAAIWAWQESVPSVACQRYI 74 Query: 66 RINAAEHPGHADDLALCRDHA---GVIGLLLPKV---ESAAQVRHAAVA--SGKPVWPIV 117 R+N+ + DL D G+ LPK E+ QV +A + I+ Sbjct: 75 RLNSVDSTFLRQDLTWLGDMRYPERCAGIFLPKAQYGEALCQVVEQLLAWQPELQIVAII 134 Query: 118 ESARGLAALGEIAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAG 177 E+A+GL + IA AG+ RL+FGSLD +LD++ S E L AR ++L +R AG Sbjct: 135 ETAKGLQQVEAIAGIAGLSRLAFGSLDFSLDINC---SQVPEAFL-FARNRIVLASRTAG 190 Query: 178 LAPPLDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARR 237 L P+DGV PAI + A + +AR +GFG LCIHP+Q+ + + +P+ +L WA R Sbjct: 191 LPAPIDGVTPAISDLAMVNHDAHYARSLGFGAKLCIHPAQLNTVQRAFLPNAGQLAWADR 250 Query: 238 VAEAGASGAGVFVVDGEMVDAPVLGRARRLLERA 271 V A ASG+ VDGEMVD P++ A+RLL+ A Sbjct: 251 VMRAVASGSHAVQVDGEMVDLPLIEHAQRLLDVA 284 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 296 Length adjustment: 26 Effective length of query: 249 Effective length of database: 270 Effective search space: 67230 Effective search space used: 67230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory