Align aquaglyceroporin (characterized)
to candidate AO356_18255 AO356_18255 glycerol uptake facilitator GlpF
Query= CharProtDB::CH_024677 (281 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_18255 Length = 283 Score = 389 bits (998), Expect = e-113 Identities = 189/278 (67%), Positives = 226/278 (81%) Query: 3 QTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGV 62 Q +L QC+AEFLGTGLLIFFG GCVAALKVAGASFG WEIS+IWG+GV+MAIYL+AG+ Sbjct: 6 QQPSLSSQCLAEFLGTGLLIFFGTGCVAALKVAGASFGLWEISLIWGVGVSMAIYLSAGI 65 Query: 63 SGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIV 122 SGAHLNPAV+IAL +F F+KRK+ +I SQV GAFC A LVY LY NLFFDFEQ+ H+V Sbjct: 66 SGAHLNPAVSIALCMFTDFEKRKLPFYIASQVTGAFCGALLVYTLYSNLFFDFEQSRHMV 125 Query: 123 RGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLL 182 RG+ S++LA FSTYP+ ++ QAF VE +ITAILMG+I++LTDD NG+PRGPLAPLL Sbjct: 126 RGTEMSLELASVFSTYPHAALSTGQAFLVEAIITAILMGVIMSLTDDNNGLPRGPLAPLL 185 Query: 183 IGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIV 242 IGLLIAVIG+SMGPLTGFAMNPARDFGPK+ + AGWG ++ TGGRDIPYFLVP+F PIV Sbjct: 186 IGLLIAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEISLTGGRDIPYFLVPIFAPIV 245 Query: 243 GAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKAS 280 GA +GA AYR LI RHLP + ++ E + + S Sbjct: 246 GACLGAAAYRGLIARHLPSAVTATKDAEPAIDGKPRTS 283 Lambda K H 0.327 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory