Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate AO356_00010 AO356_00010 ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_00010 Length = 365 Score = 210 bits (535), Expect = 4e-59 Identities = 125/336 (37%), Positives = 192/336 (57%), Gaps = 12/336 (3%) Query: 25 LKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSRNIA 84 +K +D E D +GPSGCGK+TLL +I+GL + G I DG+D+T ++ R++A Sbjct: 19 IKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTIELDGRDITEVTPAKRDLA 78 Query: 85 QVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGLTADQ 144 VFQ +Y MTV NL+F L G + DV+R+V + +++L S RK + L+ Q Sbjct: 79 MVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARILELGSLLDRKPKQLSGGQ 138 Query: 145 KQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTEA 204 +Q++++GR +VRN LFDEPL+ +D ++ R +L RLHK+ TM+YVTHDQ EA Sbjct: 139 RQRVAIGRAIVRNP-KIFLFDEPLSNLDAALRVQTRLELSRLHKELQATMIYVTHDQVEA 197 Query: 205 LTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGSPGMNFMPA---RIEGSTVKVG 261 +T A KVVV+ G+I QIG+P EL+ P++ FV F+G+P M F+ A + S V+V Sbjct: 198 MTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMGFLQATVHAVHASGVEVR 257 Query: 262 DETLTLEYAPKTSGT----AKTELGIRPEFIRLGREG-MPITISKVEDIGRQKIVRARF- 315 + T P+ S +GIRPE + LG EG + +T E +G Sbjct: 258 FASGTTLLIPRDSSALSVGQSVTIGIRPEHLTLGAEGQVLVTTDVTERLGSDTFCHVNVD 317 Query: 316 ADQPIAIVVPEDADIPADAR--VTFDPSAISIYADS 349 + + + + V D ++P AR +T D + ++ +S Sbjct: 318 SGESLTVRVQGDCEVPYAARRYLTLDVAHCHLFDES 353 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 365 Length adjustment: 29 Effective length of query: 327 Effective length of database: 336 Effective search space: 109872 Effective search space used: 109872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory