Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate AO356_21785 AO356_21785 ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_21785 Length = 260 Score = 125 bits (315), Expect = 7e-34 Identities = 76/247 (30%), Positives = 123/247 (49%), Gaps = 4/247 (1%) Query: 6 RWMLGLAFFVVFVAVWAFFTLG----GFVSPTFLASPITMAKEGWLLFTEYGFIKDIGMT 61 RW+L A ++ + W G G V+ + +P+ + + L + +G + Sbjct: 7 RWLLRAASLLLCLLFWQLAATGHWNLGLVTFANVPTPLAVIQAALGLGESGNLGRHLGSS 66 Query: 62 IWRVVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGEA 121 + RV G+ A +I V LG+A+G K E P + R +PA A+IPL IL E Sbjct: 67 LGRVFAGYGAALLIGVALGLAIGRSKWAEDLLLPPLEVLRPIPAVAWIPLAILMFPSSEL 126 Query: 122 QKILVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAETL 181 + + F G++F I L V G R L+ +A +LGAG I+ V++PGAAP I L Sbjct: 127 SMVFITFTGALFPILLNTVHGVEGVDRRLIASAKSLGAGRGAILLEVILPGAAPSIITGL 186 Query: 182 RLVLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKAL 241 + +G +W ++ AE+I GIG+ S ++ N I+ G+++IG++G+ S K L Sbjct: 187 AIGMGTSWFCLVTAEMIAGQYGIGYYTWASYTVQNYADIVVGMLLIGVLGMGSSLLIKRL 246 Query: 242 NHRLFAW 248 W Sbjct: 247 GGLFTPW 253 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 260 Length adjustment: 24 Effective length of query: 228 Effective length of database: 236 Effective search space: 53808 Effective search space used: 53808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory