Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate AO356_23505 AO356_23505 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23505 Length = 233 Score = 125 bits (313), Expect = 1e-33 Identities = 73/209 (34%), Positives = 116/209 (55%), Gaps = 3/209 (1%) Query: 22 TLGLFFCSLILGGLLSLVIVTMRV-SPHWLPNRFARAYILVFRGSPLLIQMFLVYYGMGQ 80 TL L S ++G ++ + +R WL + Y LV RG+PL +Q+ ++Y G+ Sbjct: 26 TLWLLVTSAVIGLCAAIPLALVRTYGNRWLALP-VQLYTLVLRGTPLFVQLLIIYSGLAS 84 Query: 81 FGVIRES-FLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGYSIGLSGF 139 VIRES LW R+ C +L+LAL T YT EI+ G L P G+IEA ++G++ Sbjct: 85 LSVIRESPSLWWFFRDGMHCVILALALHTCAYTVEILAGVLRTTPRGEIEAALALGMTRT 144 Query: 140 ALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTYRTTEVFI 199 L V+ P LR+ LPAYS E + ++ +TA+A TV ++ +A + T++T + + Sbjct: 145 QLFLLVLIPSMLRRALPAYSNEVIFVLHATAIAFTATVPDILKIAADVNAATFKTFQAYG 204 Query: 200 CAALIYLFLNFVIVRLLGMLETRLSRHLR 228 AAL+Y+ L +V + + E RL + R Sbjct: 205 IAALLYMLLACALVGVFRLAERRLLAYQR 233 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 233 Length adjustment: 23 Effective length of query: 227 Effective length of database: 210 Effective search space: 47670 Effective search space used: 47670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory