Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate AO356_28625 AO356_28625 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= TCDB::P73721 (252 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28625 Length = 259 Score = 255 bits (651), Expect = 7e-73 Identities = 130/244 (53%), Positives = 176/244 (72%), Gaps = 8/244 (3%) Query: 14 LQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEVAG---- 69 + K+FG LQ+L+G++ ++ +V+ +IG SG GK+TF+RC+N LE I GGR+ V G Sbjct: 15 VHKSFGELQILKGISLQVRRGEVVVLIGASGSGKTTFIRCINLLEDIQGGRIRVNGRAMG 74 Query: 70 ----VDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKD 125 D S + ++++ + R +GMVFQ FNLFPH+T L+N++ AP +VL + A + Sbjct: 75 YRERADGSLVRESERNIARQRRDIGMVFQRFNLFPHMTALENIIEAPIQVLGVSRVAALE 134 Query: 126 RALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEV 185 +A L++VGL KAD+YP LSGGQ+QRVAIAR L MKP+ +LFDEPTSALDPE VGEV Sbjct: 135 QARGLLERVGLADKADHYPSMLSGGQQQRVAIARALAMKPQAMLFDEPTSALDPETVGEV 194 Query: 186 LNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAF 245 L VMK+LAEEGMTM VVTHEM FAREV++RV +QG + E+G P ++F +P R RAF Sbjct: 195 LQVMKELAEEGMTMVVVTHEMGFAREVADRVVVLDQGELIEQGPPEQIFCHPIHPRTRAF 254 Query: 246 LSRI 249 LSR+ Sbjct: 255 LSRV 258 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 259 Length adjustment: 24 Effective length of query: 228 Effective length of database: 235 Effective search space: 53580 Effective search space used: 53580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory