Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate AO356_23515 AO356_23515 ABC transporter substrate-binding protein
Query= CharProtDB::CH_014295 (260 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23515 Length = 256 Score = 254 bits (649), Expect = 1e-72 Identities = 124/257 (48%), Positives = 169/257 (65%), Gaps = 4/257 (1%) Query: 1 MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELC 60 MKK ++ L LV +S ++ A + +R G DPTY PFESK G L GFDI+L + LC Sbjct: 1 MKKYLIGLMLV---ASPLMSWGA-NEELRFGVDPTYPPFESKRPDGSLTGFDIELGESLC 56 Query: 61 KRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAK 120 + +C +VEN D ++ +LK +K D I+S+LSITE R+ EIAF++ LY +RLV + Sbjct: 57 SELQRRCVWVENAFDGMVSALKGRKFDGILSALSITEARKAEIAFSNTLYDTPARLVAPE 116 Query: 121 NSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAA 180 S +QPT ESL+GKR+GV QG+ E + W KG+E+V YQ D YSDL GR+DAA Sbjct: 117 GSPLQPTAESLRGKRIGVQQGSVFEVYAKRMWGLKGVEVVPYQSSDLTYSDLINGRLDAA 176 Query: 181 FQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMR 240 F D +A SEG LK+P GK + + G VK ++FG GTG+GLRK D L +N+A + Sbjct: 177 FDDAIAVSEGLLKKPAGKGFGYAGEVVKSPEIFGPGTGIGLRKSDTALAGEINQALERLH 236 Query: 241 ADGTYEKLAKKYFDFDV 257 +GTYE++A KYFDFD+ Sbjct: 237 RNGTYERIASKYFDFDI 253 Lambda K H 0.315 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory