Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate AO356_26125 AO356_26125 ABC transporter substrate-binding protein
Query= CharProtDB::CH_018185 (260 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_26125 Length = 260 Score = 222 bits (565), Expect = 7e-63 Identities = 112/261 (42%), Positives = 161/261 (61%), Gaps = 6/261 (2%) Query: 1 MKKLALSLSLV--LAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKE 58 +K++AL+L + LAF A+ A +RIG + Y PF SK +VGFD D+ + Sbjct: 3 VKRIALNLGFISLLAFG---ASLQAAESSLRIGIEAAYPPFASKTPDNAIVGFDYDIGQA 59 Query: 59 LCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVV 118 LC + +C + E D LIP+LK KK+DA++SS+SIT +R + + FTD+ Y +RLV Sbjct: 60 LCAEMKVRCVWQEQEFDGLIPALKVKKVDAVISSMSITPERLKSVDFTDRYYRIPARLVF 119 Query: 119 AKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRID 178 K S I A LKGKR+GV + T + + +H+AP G E+V Y Q+ I+ DL GR+D Sbjct: 120 RKGSAISDIPAQLKGKRIGVQRATNFDRYVTDHFAPAGAEVVRYGSQNEIFLDLLGGRLD 179 Query: 179 AAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAE 238 A V E LK+P GKD++F GP +E+ FG G G+ +RK D L N+A A Sbjct: 180 ATMASSVVIDESLLKRPEGKDFEFVGPNFTEEQYFGTGIGIAVRKND-ALAGRFNQALAT 238 Query: 239 MRADGTYEKLAKKYFDFDVYG 259 +RA+GTY+++ +KYFDFD+YG Sbjct: 239 IRANGTYDRIRQKYFDFDIYG 259 Lambda K H 0.316 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory