GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdC in Pseudomonas fluorescens FW300-N2C3

Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate AO356_08965 AO356_08965 dihydrolipoamide acetyltransferase

Query= reanno::Smeli:SMc03203
         (426 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_08965 AO356_08965
           dihydrolipoamide acetyltransferase
          Length = 546

 Score =  251 bits (641), Expect = 4e-71
 Identities = 155/428 (36%), Positives = 222/428 (51%), Gaps = 28/428 (6%)

Query: 6   IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65
           I +PD+G    +A+++E  VK GD V  D  L  + +DKA++EIPSP  G V  +  ++ 
Sbjct: 122 IHVPDIGSS-GKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESVEIKLE 180

Query: 66  DTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPKP 125
           D V     +++++ AG +  AAP       A+       A +   +A+A P P   AP P
Sbjct: 181 DEVGTGDLILKLKVAGASAPAAPAPAAAPAAKAEAAPAPAAAPAAKAEAAPAPVAAAPAP 240

Query: 126 APAPREAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISR------ 179
           +          AK  A PAVR  ARE G++L  V  +GP GR+  ED+  ++        
Sbjct: 241 S---------GAKVHAGPAVRQLAREFGVELSAVGPSGPHGRVLKEDVQAYVKAMMQKAK 291

Query: 180 -----------GAEPLPAQTGLVRKTAVEEVRMIGLRRRIAEKMSLSTSRIPHITYVEEV 228
                      G  P+PA     R    EEV M  L +  A  +  S   IPH+T  ++ 
Sbjct: 292 NAPAEGATGGAGIPPIPA-VDFSRFGETEEVAMTRLMQIGASSLHRSWLNIPHVTQFDQA 350

Query: 229 DMTALEDLRATMNRDRKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHRHAAV 288
           D+T LE  R       +    KLT+LP L++A    + E P  N++       + R   V
Sbjct: 351 DITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKAVIRKKYV 410

Query: 289 HIGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITISSLG 348
           HIG A  TP GL VPV+R+ + + +   A E   LA+ AR    T D++ G+  TISSLG
Sbjct: 411 HIGFAVDTPEGLLVPVIRNVDQKSLLQLAGEAAALAEKARNKKLTADDMQGACFTISSLG 470

Query: 349 AIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWDAAVF 408
            IGG   TP++N PEVAI+GV+K  ++PVWDG  F P+ ++ LS S+DHRVI+G  AA F
Sbjct: 471 HIGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARF 530

Query: 409 VQRLKTLL 416
            +RL  LL
Sbjct: 531 TKRLSDLL 538



 Score = 72.8 bits (177), Expect = 2e-17
 Identities = 44/138 (31%), Positives = 70/138 (50%), Gaps = 12/138 (8%)

Query: 5   IIKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEV 64
           +I++PD+G G  E E++E  VK GD +  D  +  + +DKA++E+P+P  G +  L  ++
Sbjct: 4   LIRVPDIGSG--EGEVIELFVKVGDRIEADQSILTLESDKASMEVPAPKAGVIKSLKVKL 61

Query: 65  GDTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPK 124
           GD +     L+ +E  G A  AAP++   A A    ++P A        AP     PAP 
Sbjct: 62  GDRLKEGDELLELEVEGAA--AAPEAAAPAAAPAAAEKPAA--------APAAEAAPAPA 111

Query: 125 PAPAPREAPDLSAKPLAS 142
            APA     D+    + S
Sbjct: 112 AAPAAATVQDIHVPDIGS 129


Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 589
Number of extensions: 26
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 4
Number of HSP's successfully gapped: 3
Length of query: 426
Length of database: 546
Length adjustment: 34
Effective length of query: 392
Effective length of database: 512
Effective search space:   200704
Effective search space used:   200704
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory