Align galactaro-1,5-lactonase (characterized)
to candidate AO356_23060 AO356_23060 gluconolactonase
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23060 Length = 301 Score = 466 bits (1198), Expect = e-136 Identities = 226/293 (77%), Positives = 244/293 (83%), Gaps = 4/293 (1%) Query: 1 MNAELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIAR 60 M AELIVDARNAVGE PVWVP ENALYWV+IP GGLQRW+A++G + W AP+MLACIAR Sbjct: 1 MQAELIVDARNAVGESPVWVPEENALYWVNIPSGGLQRWNASSGKIQGWEAPEMLACIAR 60 Query: 61 TDAGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVL 120 G WVAGME+GFF+L PH+DGSLD+ L +VEH R DMRLNDGRCDRQGRFWAGSMVL Sbjct: 61 HQDGGWVAGMESGFFRLHPHDDGSLDSELCGSVEHSRVDMRLNDGRCDRQGRFWAGSMVL 120 Query: 121 NMGLNAAEGTLYRYTSG--AAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFD 178 NM N EG +YRY +G + AQL GFI NGL FSPDGRTMY SDSHPL QQIWAFD Sbjct: 121 NMAANVDEGRMYRYEAGQRSPVEAQLSGFIVPNGLGFSPDGRTMYLSDSHPLSQQIWAFD 180 Query: 179 YDIDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTV 238 YDID+GTPSNRR+FVDM GRPDGAAVDADGCYWICANDAGLIHRF+PDGRLDRSL V Sbjct: 181 YDIDSGTPSNRRLFVDMLPLAGRPDGAAVDADGCYWICANDAGLIHRFTPDGRLDRSLEV 240 Query: 239 PVKKPTMCAFGGSRLDTLFVTSIR--DDQSEQSLSGGVFALNPGVVGLPEPTF 289 PVKKPTMCAFGGSRLDTLFVTSIR DD QSL+GGVFAL PGV GL EP F Sbjct: 241 PVKKPTMCAFGGSRLDTLFVTSIRPGDDNDPQSLAGGVFALKPGVKGLAEPVF 293 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 301 Length adjustment: 26 Effective length of query: 265 Effective length of database: 275 Effective search space: 72875 Effective search space used: 72875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory