Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate AO356_02330 AO356_02330 multifunctional fatty acid oxidation complex subunit alpha
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_02330 Length = 715 Score = 114 bits (284), Expect = 9e-30 Identities = 74/188 (39%), Positives = 103/188 (54%), Gaps = 5/188 (2%) Query: 52 DSGIIEVNLD-RPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLK 110 +SGI+E+ D + + N N+ L L+ A ++I D S + V++ S VF GAD+ Sbjct: 14 ESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS-GKDVFIVGADIT 72 Query: 111 E---RRTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGE 167 E + +E+ +FS E L++PT+AAI G ALGGGLEM LA D R+ Sbjct: 73 EFVDNFKLPDAELIAGNLEANRIFSDFEDLNVPTVAAINGIALGGGLEMCLAADYRVMAT 132 Query: 168 NAVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAG 227 A GLPE L I PG GGT RL RL+G + E I G++ A +A G V+ V G Sbjct: 133 TAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDALKVGAVDAVVEPG 192 Query: 228 EAHEKAIE 235 + HE A+E Sbjct: 193 KLHEAALE 200 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 715 Length adjustment: 33 Effective length of query: 268 Effective length of database: 682 Effective search space: 182776 Effective search space used: 182776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory