Align pipecolate oxidase (EC 1.5.3.7) (characterized)
to candidate AO356_00055 AO356_00055 oxidoreductase
Query= metacyc::G1G01-5614-MONOMER (432 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_00055 Length = 433 Score = 158 bits (400), Expect = 3e-43 Identities = 112/382 (29%), Positives = 184/382 (48%), Gaps = 9/382 (2%) Query: 13 LWEHVSKPTVAAQALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIVLEAWKIGHGGSG 72 LW+ + + AL G+ DV V+GGG TGLS A +L ++G + +VLEA +IG G SG Sbjct: 13 LWQSTAVDAPSFPALEGDRSYDVVVVGGGYTGLSTAHYLAKKGLATVVLEASRIGWGASG 72 Query: 73 RNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEAPAEVFAMIERLGID-CQAQHKGTL 131 RN G+V+A I V A G + + ++ E+ + ++ ++ Q + G+L Sbjct: 73 RNGGVVSAKYRISLSKVAARYGLEMAQTMRRLSLESVEHLEELVAVYSLEAAQYRRSGSL 132 Query: 132 HMAHNATGIADLEARHEQWRRR---GADVELLTGAQCQEYCGTDKISAALLDRRAGTINP 188 H AHN + D R QW + E+L Q QE G+ +LDR G ++P Sbjct: 133 HCAHNEATL-DYCVREAQWLHEHLGDSSFEVLCAGQMQEETGSGDFVGGVLDRGGGLLHP 191 Query: 189 MGYTQGLAAAVTRLGGKIFQQSSVEGLEREGDGWRVKTARGAVRAEKVVISTGAYTE--G 246 + + +GLA V+ G I + + V G+ R G G RV+T G VRA++VV++T Y+ Sbjct: 192 LNFVRGLADGVSAAGVSIHEGAPVMGIRRMGTGVRVETPTGTVRAKQVVLATNGYSSLTP 251 Query: 247 DWSNLQKQFFRGYYYQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGRLLLGSL 306 + ++K +A++PL G + +L HG+ +TR ++ R + RLL G Sbjct: 252 ATAPVRKSVVPFRSAMLATEPLTGPQLE-LLRHGRSYTETRRMMRWFRMAED-RLLYGGR 309 Query: 307 GRVDNKPAWFVRSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAPGLVAVT 366 G + + +P L + W+G + T D + + +V Sbjct: 310 GAFGTDDSEAAFNALHEAMVKQFPLLARATITHRWSGLVALTIDSVPHVGRIDDRVVYAM 369 Query: 367 GYNGRGNTTGTVIGRAFAEFLL 388 GYNG G + IG+ A+ ++ Sbjct: 370 GYNGTGVAMSSYIGKHVADVIV 391 Lambda K H 0.319 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 485 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 433 Length adjustment: 32 Effective length of query: 400 Effective length of database: 401 Effective search space: 160400 Effective search space used: 160400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory