Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate AO356_20325 AO356_20325 electron transfer flavoprotein subunit beta
Query= BRENDA::D2RIQ3 (340 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_20325 Length = 309 Score = 147 bits (372), Expect = 3e-40 Identities = 86/229 (37%), Positives = 130/229 (56%), Gaps = 8/229 (3%) Query: 102 SSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKE 161 S + AT++G+++ PR+AA ++ ++ +++ + + RP GN +AT+ Sbjct: 85 SHILAAATSNGKNILPRVAAALDVDQISEIISVESADT----FKRPIYAGNAIATVQSNA 140 Query: 162 HRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPF 221 ++ TVR F +P A+ G + D ++ EE+ + A Sbjct: 141 S-VKVITVRATGF---DPVAAEGGSAAIEAVAAAHDTGISSFVGEELAKSDRPELTAAKI 196 Query: 222 VCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFA 281 V SGGRGM+ +NF LY LA LG AVG SRAAVD GF+ + QVGQ+GK V P++Y A Sbjct: 197 VVSGGRGMQNGDNFKHLYALADKLGAAVGASRAAVDAGFVPNDMQVGQTGKIVAPQLYIA 256 Query: 282 CGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLL 330 GISG++QH AGM S IV INKD +AP+F+++ YG+V D + +P L Sbjct: 257 VGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVADLFEAIPEL 305 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 309 Length adjustment: 28 Effective length of query: 312 Effective length of database: 281 Effective search space: 87672 Effective search space used: 87672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory