GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glk in Pseudomonas fluorescens FW300-N2C3

Align Glucokinase (EC 2.7.1.2) (characterized)
to candidate AO356_05215 AO356_05215 glucokinase

Query= reanno::WCS417:GFF4431
         (318 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215 AO356_05215
           glucokinase
          Length = 318

 Score =  555 bits (1430), Expect = e-163
 Identities = 268/318 (84%), Positives = 294/318 (92%)

Query: 1   MKLALVGDIGGTNARFALWRDQELHSIRVHATADHSSPEDAIKVYLKEEGLEIGDIGAVC 60
           +KLALVGDIGGTNARFALW+D  L +I+V ATAD++ PEDAI+VYL   GL+ G IG+VC
Sbjct: 1   LKLALVGDIGGTNARFALWKDHTLENIQVLATADYACPEDAIQVYLGGLGLKPGAIGSVC 60

Query: 61  LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC 120
           LSVAGPVSGDEF+FTNNHWRLS  AFCKTLQV++LLLVNDFSAMALGMT L+PDE+RVVC
Sbjct: 61  LSVAGPVSGDEFRFTNNHWRLSNLAFCKTLQVEKLLLVNDFSAMALGMTCLRPDEYRVVC 120

Query: 121 EGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYT 180
           EGTPEP+RPAVVIGPGTGLGVGTLLDLG GRFAALPGEGGHVDLP+SSPRETQLWQHIY 
Sbjct: 121 EGTPEPMRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPMSSPRETQLWQHIYN 180

Query: 181 EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW 240
           EIGHVSAETALSG GLPR+YRAICAVDGH PVL+TPE+ITAAGLAGDP+A+EVL+QF  W
Sbjct: 181 EIGHVSAETALSGSGLPRVYRAICAVDGHVPVLDTPESITAAGLAGDPIALEVLEQFCRW 240

Query: 241 LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFINSGFAKSFADKGCMSDYFKGIPVWLVT 300
           LGRVAGNNVLT GGRGGVYIVGGV+PRFADFF+ SGFA+ FADKGCMSDYFKGIPVWLVT
Sbjct: 241 LGRVAGNNVLTLGGRGGVYIVGGVVPRFADFFLESGFARCFADKGCMSDYFKGIPVWLVT 300

Query: 301 APYSGLTGAGVALEQAFA 318
           APYSGL GAGVALEQ+ A
Sbjct: 301 APYSGLMGAGVALEQSAA 318


Lambda     K      H
   0.320    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 465
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 318
Length of database: 318
Length adjustment: 27
Effective length of query: 291
Effective length of database: 291
Effective search space:    84681
Effective search space used:    84681
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate AO356_05215 AO356_05215 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00749.hmm
# target sequence database:        /tmp/gapView.19046.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00749  [M=315]
Accession:   TIGR00749
Description: glk: glucokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
    4.7e-82  261.7   0.0    5.4e-82  261.5   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215  AO356_05215 glucokinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215  AO356_05215 glucokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  261.5   0.0   5.4e-82   5.4e-82       1     315 []       5     310 ..       5     310 .. 0.96

  Alignments for each domain:
  == domain 1  score: 261.5 bits;  conditional E-value: 5.4e-82
                                       TIGR00749   1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpi.kgcfaia 62 
                                                     lvgdiGGtnar+al       +e+++++ + d+   e++++vyl     + +  i   c+++a
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215   5 LVGDIGGTNARFAL--WKDHTLENIQVLATADYACPEDAIQVYLGGLGLKPGA-IgSVCLSVA 64 
                                                     89************..78899***********************999888887.5599***** PP

                                       TIGR00749  63 tPiigdfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakvees 125
                                                     +P+ gd  r+tn++W ls     ++l ++kl l+ndf+a+a++++ l+ ++  ++    +e+ 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215  65 GPVSGDEFRFTNNHWRLSNLAFCKTLQVEKLLLVNDFSAMALGMTCLRPDEYRVVCEGTPEPM 127
                                                     *************************************************************** PP

                                       TIGR00749 126 aaiailGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaerv 188
                                                      +  ++G+GtGlGv tl++ ++gr+ +l+geGghvd+   s+ e++l++ + +++g+vsae  
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215 128 RPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPMSSPRETQLWQHIYNEIGHVSAETA 190
                                                     *************************************************************** PP

                                       TIGR00749 189 lsGsGlvliyealskrkgerevsklskeelkekdiseaalegsdvlarralelflsilGalag 251
                                                     lsGsGl  +y+a+   +g  +v  l     +++ i+ a l+g+ ++a + le f+  lG++ag
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215 191 LSGSGLPRVYRAICAVDG--HVPVLD----TPESITAAGLAGD-PIALEVLEQFCRWLGRVAG 246
                                                     ***************994..344455....99*********96.89999************** PP

                                       TIGR00749 252 nlalklgarGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGa 314
                                                     n  l+lg rGGvy++GG+vPrf +++ +s+f   f dkG + ++++ iPv +v     Gl+Ga
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215 247 NNVLTLGGRGGVYIVGGVVPRFADFFLESGFARCFADKGCMSDYFKGIPVWLVTAPYSGLMGA 309
                                                     **************************************************************9 PP

                                       TIGR00749 315 g 315
                                                     g
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_05215 310 G 310
                                                     7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (315 nodes)
Target sequences:                          1  (318 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 9.86
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory