Align MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)
to candidate AO356_27685 AO356_27685 ABC transporter ATP-binding protein
Query= TCDB::Q9X103 (369 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27685 Length = 367 Score = 340 bits (872), Expect = 4e-98 Identities = 180/364 (49%), Positives = 251/364 (68%), Gaps = 12/364 (3%) Query: 3 MAQVVLENVTKVYENKVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITDGK 62 MA + ++N+ K +E + +K +L V D+EFVV +GPSGCGK+T LR+IAGLEE++DG Sbjct: 1 MANLKIKNLQKGFEGFSI-IKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVSDGT 59 Query: 63 IYIDGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREAAK 122 I +DG+ + +V P RD+AMVFQ YALYPHM+V +NM+F L L PK E++++V EAA+ Sbjct: 60 IELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVPKAEVEKKVNEAAR 119 Query: 123 ILGIENLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELKKL 182 IL + +L+RKP+QLSGGQRQRVA+GRAIVRNPK+FLFDEPLSNLDA LRVQMR EL +L Sbjct: 120 ILELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARL 179 Query: 183 HHRLQATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFIGSPPM 242 H LQAT+IYVTHDQVEAMT+ADK+VV+ G I+Q+G+P E+Y+ PAN+FVAGF+G+P M Sbjct: 180 HKELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPLELYHQPANLFVAGFLGTPKM 239 Query: 243 NFVNARV--VRGEGGLWIQASGFKVKVPKEFEDKLANYIDKEIIFGIRPEDIYDKLFALA 300 F+ +V + +G + +G ++ +P+ + + + GIRPE + LA Sbjct: 240 GFLKGKVTALDSQGCEVLLDAGTRINLPRSGANL---SVGGAVTLGIRPEHL-----NLA 291 Query: 301 PSPENTITGVVDVVEPLGSETILH-VKVGDDLIVASVNPRTQAKEEQKIDLVLDMTRMHA 359 + T+ DV E LGS+T H V + + V ++ ++++L LD H Sbjct: 292 QPGDCTLQVTADVSERLGSDTFCHVVTTSGEALTMRVRGDLASRFGEQLNLHLDAEHCHL 351 Query: 360 FDKE 363 FD E Sbjct: 352 FDAE 355 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 367 Length adjustment: 30 Effective length of query: 339 Effective length of database: 337 Effective search space: 114243 Effective search space used: 114243 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory