Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate AO356_28585 AO356_28585 ABC transporter
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28585 Length = 379 Score = 271 bits (692), Expect = 3e-77 Identities = 144/304 (47%), Positives = 203/304 (66%), Gaps = 16/304 (5%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 ++ +LEI+ GEF+V VGPSGCGKST LR++AGL+++ G + I + V + PR+R + Sbjct: 19 LRDVSLEISAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPRERGVG 78 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+YALYPHM+V +N+ F LK+A + + +RV + A L L + L+RKP+ LSGGQ Sbjct: 79 MVFQSYALYPHMSVYDNISFGLKLAKTEKTSLRERVLKTAQILQLDKLLQRKPRELSGGQ 138 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVAMGRA+ R P + L DEPLSNLDA LRVQ R +IA L +LG T +YVTHDQ EA+ Sbjct: 139 RQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHGRLGSTMIYVTHDQVEAM 198 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMN-LGTFSVKDGDATS---- 255 T+ D+I VL G ++QVG+PRELY+RPA+ FVAGF+GSP MN L F G+ + Sbjct: 199 TLADKIVVLNGGRIEQVGSPRELYERPASRFVAGFLGSPRMNFLAAFLHTPGETSQVESL 258 Query: 256 --GHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLSIPIKLDFVEELGSD 313 G + LAA N ++++G RPE + + ++ + I + VE LGS+ Sbjct: 259 VLGMTSLPFDSSGLAA-----NTQLSLGIRPEHIAL----KAAQGTAGIAVSGVEYLGSE 309 Query: 314 SFLY 317 ++++ Sbjct: 310 TYVH 313 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 379 Length adjustment: 30 Effective length of query: 346 Effective length of database: 349 Effective search space: 120754 Effective search space used: 120754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory