Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate AO356_28580 AO356_28580 sugar ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28580 Length = 280 Score = 379 bits (973), Expect = e-110 Identities = 183/269 (68%), Positives = 229/269 (85%) Query: 8 RTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFSHGTFVRN 67 R F+ L+A++++ AVFPFYYAI+TSLK +ALF++ YW +NYA + + +F+R Sbjct: 12 RLGFWCLIAILLVYAVFPFYYAIVTSLKPSSALFQVSYWIDQPDFSNYAAVLNQASFLRA 71 Query: 68 LGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLAGLFELI 127 +GNSL+VA VVA++L L++TAAYAL RV+FRGRG +L+ +L VSMFPQ+AVL+GLFE+I Sbjct: 72 IGNSLVVALCVVALALFLSLTAAYALGRVKFRGRGPVLMMVLGVSMFPQVAVLSGLFEVI 131 Query: 128 RFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVVITRVFMP 187 R +G++NT ALI SY IFTLPFTVWVLTTFM LP E+EEAAI+DGASPWV +TRV +P Sbjct: 132 RALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLP 191 Query: 188 LMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPWGNIMAAS 247 L+WPALVTTGLLAFIAAWNEFLFALTFT +++QRTVPVAIAL+SGGS E+PWG +MAAS Sbjct: 192 LLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPHELPWGLLMAAS 251 Query: 248 VIVTVPLVVLVLIFQRRIISGLTAGGVKG 276 V+VTVPLV+LVLIFQRRI+SGLTAG +KG Sbjct: 252 VLVTVPLVILVLIFQRRIVSGLTAGALKG 280 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 280 Length adjustment: 25 Effective length of query: 251 Effective length of database: 255 Effective search space: 64005 Effective search space used: 64005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory