Align Mannitol-specific phosphotransferase enzyme IIA component (characterized, see rationale)
to candidate AO356_07335 AO356_07335 PTS fructose transporter subunit IIA
Query= uniprot:Q45420 (145 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07335 Length = 954 Score = 97.4 bits (241), Expect = 5e-25 Identities = 51/136 (37%), Positives = 79/136 (58%) Query: 6 LKKENIVLHARVENKTEAIRLAGQILVNNGYVEDSYIDKMFEREALTSTYMGNFIAIPHG 65 L E I + +K A++L LV +G V + Y+ + REA ST++G IAIPHG Sbjct: 4 LTLEQISMAQTAVDKDAALQLLADKLVADGLVAEGYLAGLQAREAQGSTFLGQGIAIPHG 63 Query: 66 TEDAKQFVKHSGISIIQIPDGVDFGDGNIVKLLIGIAGKNNEHLEILSKIAIVCSEVENV 125 T + V +G+ ++Q P+GVD+GDG IV L IGIA K++EHL +L + E + Sbjct: 64 TPQTRDLVYSTGVRLLQFPEGVDWGDGQIVYLAIGIAAKSDEHLRLLQLLTRALGETDLG 123 Query: 126 ETMIKAATEEEILSIL 141 + + +A + E +L +L Sbjct: 124 QALRRAGSAEALLKLL 139 Lambda K H 0.316 0.135 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 145 Length of database: 954 Length adjustment: 29 Effective length of query: 116 Effective length of database: 925 Effective search space: 107300 Effective search space used: 107300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory