Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate AO356_28575 AO356_28575 ABC transporter permease
Query= TCDB::O30832 (290 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28575 Length = 320 Score = 128 bits (321), Expect = 2e-34 Identities = 95/295 (32%), Positives = 155/295 (52%), Gaps = 19/295 (6%) Query: 9 AARLMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYY--------FL 60 AA L ++P ++ L L PL T +FS +L G +F G NY + L Sbjct: 28 AAWLFLTPMLLCLALVAAWPLLRTFWFSLTDASLADTGDATFVGLSNYLFHSSAGWSGLL 87 Query: 61 TDPAFSAALTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSA 120 DP + A+ NT+ V + + +V G+L+ALLL+ F G+ +VR L++ P+ + VSA Sbjct: 88 VDPQWWNAVRNTLHFTVVSVGLEIVLGLLVALLLNVRFSGRALVRALILIPWAIPTIVSA 147 Query: 121 LVWKNMFMNPVNGMFAHIARGLGL--PPFDFLSQAPLA--SIIGIVAWQWLPFATLILLT 176 +W M +N G+ H+ GLGL P + + A L+ ++I + W+ +PF TL++L Sbjct: 148 KIWSWM-LNDQFGIINHLMLGLGLIDAPLAWTADADLSMWAVIIVDVWKTVPFVTLLMLA 206 Query: 177 ALQSLDREQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNG 236 ALQ L + EAA +DG + F +T+P L A+ V + + + L VF I V T+ Sbjct: 207 ALQMLPSDCYEAARVDGIHPVKVFWRVTLPLLMPALLVAAIFRILDSLRVFDVIYVLTSN 266 Query: 237 GPGTASTNITYLVYA-QSLLNY-DVGGGSAGGIVAVVLANIVAIFLMRMIGKNLD 289 T S + VYA Q L+ + DVG GSA + ++ ++A+ + + + L+ Sbjct: 267 SSSTMSMS----VYARQHLVEFQDVGYGSAASTLLFLVVAVIAMVYLYLGRRQLE 317 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 320 Length adjustment: 27 Effective length of query: 263 Effective length of database: 293 Effective search space: 77059 Effective search space used: 77059 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory