Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate AO356_28585 AO356_28585 ABC transporter
Query= TCDB::O30494 (367 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28585 Length = 379 Score = 358 bits (920), Expect = e-103 Identities = 187/356 (52%), Positives = 249/356 (69%), Gaps = 2/356 (0%) Query: 4 LKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTIELD 63 LK+ N+ K G I++ + LE++ EFVVFVGPSGCGKSTLLRLIAGL+ + G + +D Sbjct: 4 LKLDNVNKQLGGARILRDVSLEISAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLID 63 Query: 64 GRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAARILEL 123 GR + ++ P +R + MVFQ+YALYPHMSV N+SF L LA +K + +V + A+IL+L Sbjct: 64 GRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTEKTSLRERVLKTAQILQL 123 Query: 124 GPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHKEL 183 LL+RKP++LSGGQRQRVA+GRA+ R P I LFDEPLSNLDA+LRVQMR E+ARLH L Sbjct: 124 DKLLQRKPRELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHGRL 183 Query: 184 QATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKMGFLK 243 +TMIYVTHDQVEAMTLADK+VVLN GRIEQVGSP ELY +PA+ FVAGFLG+P+M FL Sbjct: 184 GSTMIYVTHDQVEAMTLADKIVVLNGGRIEQVGSPRELYERPASRFVAGFLGSPRMNFL- 242 Query: 244 GKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVTLGIRPEHLEIASPGQTTLTVTAD 303 G+ +V+ + SLP + L+ + ++LGIRPEH+ + + Q T + Sbjct: 243 AAFLHTPGETSQVESLVLGMTSLPFDSSGLAANTQLSLGIRPEHIALKA-AQGTAGIAVS 301 Query: 304 VGERLGSDTFCHVITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFDTDGVAV 359 E LGS+T+ H+ T +P+ R + + G+ + L LD + H+FDT G A+ Sbjct: 302 GVEYLGSETYVHLDTGQDDPMVCRCEVNAGWRVGDRVELQLDIDNLHVFDTHGTAL 357 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 379 Length adjustment: 30 Effective length of query: 337 Effective length of database: 349 Effective search space: 117613 Effective search space used: 117613 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory