Align Fructose import permease protein FrcC (characterized)
to candidate AO356_23210 AO356_23210 ABC transporter
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23210 Length = 340 Score = 170 bits (430), Expect = 6e-47 Identities = 113/345 (32%), Positives = 179/345 (51%), Gaps = 44/345 (12%) Query: 43 LHSSPAAVP--------------LIVLVLSLI--AFGVILGGKFFSAFTMTLILQ--QVA 84 L + PAA P L+++ + L+ FG I+ + F + L+L QV+ Sbjct: 5 LENKPAAAPTRSRRRLPTELSIFLVLIGIGLVFEMFGWIMRDQSFLMNSQRLVLMILQVS 64 Query: 85 IVGIVGAAQTLVILTAGIDLSVGAIMVLSSVIMGQFTFRYGF-----------PPALSVI 133 I+G++ T VI+T GIDLS G+++ LS++I F P + V+ Sbjct: 65 IIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIPVV 124 Query: 134 CGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLASNFLYSANETIRAQDISANASIL 193 GLGVG L G ING+++A +PPFI TLGM Y+ + + S A Sbjct: 125 AGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTA--- 181 Query: 194 QFFGQNFRIGNAVFTYGVVVMVLLVCLLWYV-LNRTAWGRYVYAVGDDPEAAKLAGVNVT 252 IG+ V++ L+V +++++ L T +G+Y YA+G + +AA+ +G+NV Sbjct: 182 --------IGHGAMP---VIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVK 230 Query: 253 RMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIESITAVVIGGISLFGGRGSIMG 312 R L+ +Y+++GL+ LAG R + G +++I A VIGG SL GG G I G Sbjct: 231 RHLVIVYSIAGLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITG 290 Query: 313 MLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVAIDQWIRK 357 + GALI+GV + G +G D ++ GL+I++AV IDQ+ K Sbjct: 291 TVIGALILGVMASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNK 335 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 340 Length adjustment: 29 Effective length of query: 331 Effective length of database: 311 Effective search space: 102941 Effective search space used: 102941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory