GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_11890 in Pseudomonas fluorescens FW300-N2C3

Align Inositol transport system ATP-binding protein (characterized)
to candidate AO356_28510 AO356_28510 xylose transporter

Query= reanno::WCS417:GFF2332
         (517 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_28510 AO356_28510 xylose
           transporter
          Length = 518

 Score =  376 bits (966), Expect = e-109
 Identities = 213/500 (42%), Positives = 314/500 (62%), Gaps = 11/500 (2%)

Query: 22  YLLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGAGKSTLMKIIAGIYQPDA--GE 79
           YLL++  I K F GV AL  + ++VRPG  + L GENGAGKSTLMK+++ +Y      GE
Sbjct: 4   YLLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPHGTWEGE 63

Query: 80  IRLRGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIWIGREQLNSLHMVNHREMHR 139
           I   G+P+  ++    + AGI +IHQEL L+P +S+AENI++G E       +N+  M  
Sbjct: 64  IIWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGRMNYPAMIH 123

Query: 140 CTAELLARLRI-NLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITEKEVAH 198
               L+  L++ +++    V       +Q+VEIAKA++  + +LI+DEP+SA+T  E+  
Sbjct: 124 RAEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEV 183

Query: 199 LFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIGLQRADSMNSDSLISMMVG 258
           L  II DLK++G   VYI+HK++EV A+ D ++V RDG +I       M+   +I+ MVG
Sbjct: 184 LLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMTDMDIPKIITQMVG 243

Query: 259 RELSQLFPLRETPIGDLLLTVRDLTLDGV-------FKDVSFDLHAGEILGIAGLMGSGR 311
           RE+S L+P     IG+++   R +T   V         D+SF L  GEILGIAGL+G+GR
Sbjct: 244 REMSNLYPTEPHDIGEVIFEARHVTCYDVDNPRRKRVDDISFVLKRGEILGIAGLVGAGR 303

Query: 312 TNVAETIFGITPSS-SGQITLDGKAVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLEN 370
           T +   +FG  P    G++ L+G+ +    P  +I  G  ++ EDRK  G+ P L V +N
Sbjct: 304 TELVSALFGAYPGRYEGEVWLNGQQIDTRTPLKSIRAGLCMVPEDRKRQGIIPDLGVGQN 363

Query: 371 MEMAVLPHYTGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWLM 430
           + +AVL +Y+    I  +A     +    ++ +KT S    I +LSGGNQQKA+LA+ L+
Sbjct: 364 ITLAVLDNYSKLTRIDAEAELGSIDKEIARMHLKTASPFLPITSLSGGNQQKAVLAKMLL 423

Query: 431 TNPRLLILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLGMSDRVMVMHEG 490
           T PR+LILDEPTRG+DVGAK EIY+L+  LA+EG+++IM+SSEL EVLG+SDRV+V+ +G
Sbjct: 424 TKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVSDRVLVIGDG 483

Query: 491 ELMGTLDRSEATQEKVMQLA 510
           +L G     E TQE+V+  A
Sbjct: 484 QLRGDFINHELTQEQVLAAA 503


Lambda     K      H
   0.320    0.136    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 591
Number of extensions: 30
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 517
Length of database: 518
Length adjustment: 35
Effective length of query: 482
Effective length of database: 483
Effective search space:   232806
Effective search space used:   232806
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory