Align dihydromonapterin reductase (EC 1.5.1.50) (characterized)
to candidate AO356_16745 AO356_16745 dihydrofolate reductase
Query= BRENDA::P0AFS3 (240 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_16745 Length = 236 Score = 205 bits (521), Expect = 7e-58 Identities = 108/234 (46%), Positives = 152/234 (64%), Gaps = 5/234 (2%) Query: 8 PILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFSTNDGVMA 67 PILITG +R+GL A + PVI +YRT P + L + GA + ADFS+ G++A Sbjct: 7 PILITGAAQRVGLHCARRLLEDGHPVIATYRTERPGVQTLRDLGAVVLFADFSSETGILA 66 Query: 68 FADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLN-HALERLLRG 126 F +++ + T LRAI+HNASAW+AE PG+ A A M +H+ PYL+N H E LLR Sbjct: 67 FIEQLKQHTDRLRAIVHNASAWLAEGPGSEAAAFNA-MFGVHMLAPYLINLHCAELLLRS 125 Query: 127 HGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIAPSLILF 186 +DI+H +D V +GS +HIAY A+KA L+++T SFA K AP +KVN IAP+L+LF Sbjct: 126 ---TPADIVHISDDVTRKGSARHIAYCATKAGLESLTLSFAAKFAPAIKVNGIAPALLLF 182 Query: 187 NEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR 240 N DDA YR +AL KS + PG + + + YLL + +VTG + ++GGRH++ Sbjct: 183 NPEDDAAYRAKALAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK 236 Lambda K H 0.322 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 236 Length adjustment: 23 Effective length of query: 217 Effective length of database: 213 Effective search space: 46221 Effective search space used: 46221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory