Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate AO356_28995 AO356_28995 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28995 Length = 258 Score = 189 bits (481), Expect = 3e-53 Identities = 104/244 (42%), Positives = 158/244 (64%), Gaps = 6/244 (2%) Query: 2 TTNILKVQQLSVAY-GGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRV 60 ++ +L VQ + V Y G I AV G+ L V +G++V L+GANGAGK+TTLKAI+G + A R Sbjct: 11 SSELLAVQDIEVIYDGAILAVAGVSLRVGQGDIVALLGANGAGKSTTLKAISGLVQADRA 70 Query: 61 E---GHIEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYT-SDDKGQI 116 + G I + GQ G + L + + V EGR VF ++I++NL G + + ++ Sbjct: 71 QVSRGRIVFQGQDTAGVAANLLARRGIVHVLEGRHVFAHLTIEDNLRSGGFLRKPTRREL 130 Query: 117 AADIDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMV 176 D+++ +A FPRLK + AG SGGEQQMLA+ RALM+ P+L+LLDEPSMGL+PI+V Sbjct: 131 EHDLERIYAWFPRLKTKRKTQAGLTSGGEQQMLAIGRALMTQPRLVLLDEPSMGLAPILV 190 Query: 177 EKIFEVIRNVSAQ-GITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKA 235 E+IF ++ ++AQ G++ L+ EQN +AL A Y++E+G + +G A ++ ++ Sbjct: 191 EEIFAIVAQLNAQEGVSFLVAEQNINVALRHASYAYILENGRVVGEGDATELAAREDLQH 250 Query: 236 AYLG 239 YLG Sbjct: 251 FYLG 254 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 258 Length adjustment: 24 Effective length of query: 217 Effective length of database: 234 Effective search space: 50778 Effective search space used: 50778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory