Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate AO356_09255 AO356_09255 glycine/betaine ABC transporter
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_09255 Length = 372 Score = 276 bits (705), Expect = 6e-79 Identities = 140/262 (53%), Positives = 191/262 (72%), Gaps = 1/262 (0%) Query: 4 IEIRNVYKIFGHDAKKAL-TMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLS 62 ++ +NV+KIFG A A+ +V+ GL K IL C VG+++VSL++ G+IF IMGLS Sbjct: 13 VDCQNVWKIFGESAPAAMQAVVQQGLTKTRILQDYSCVVGVSNVSLQVRRGEIFCIMGLS 72 Query: 63 GSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTV 122 GSGKSTL+R +N+LI P+SG+VL G ++ L A LR R R + MVFQS AL+P+RTV Sbjct: 73 GSGKSTLIRLLNKLITPSSGKVLVKGKDLSTLSAAQLREVRARHIGMVFQSVALLPNRTV 132 Query: 123 LQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADT 182 L+N +G V+G+ K + ++ + + VGLS + ++P +LSGGM+QRVGLARA+ AD Sbjct: 133 LENTAFGLEVQGIGKAERYKVAERALAKVGLSEWSQRYPSELSGGMQQRVGLARAITADP 192 Query: 183 DVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQV 242 +VILMDE FSALDPLIR +QD+ QL + L K+ VFITHDLDEA+RIG IAI++DG + Sbjct: 193 EVILMDEPFSALDPLIRRQLQDEFRQLTKELGKSAVFITHDLDEAIRIGDRIAIMKDGVI 252 Query: 243 VQVGTPNDILDNPANDYVARFV 264 +QVGT +I+ PA+DYVA FV Sbjct: 253 IQVGTAEEIVLKPADDYVAEFV 274 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 372 Length adjustment: 28 Effective length of query: 247 Effective length of database: 344 Effective search space: 84968 Effective search space used: 84968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory