Align L-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.2 (characterized)
to candidate AO356_26445 AO356_26445 FAD-dependent oxidoreductase
Query= SwissProt::Q9LES4 (483 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_26445 Length = 368 Score = 353 bits (907), Expect = e-102 Identities = 185/398 (46%), Positives = 250/398 (62%), Gaps = 40/398 (10%) Query: 80 VDTVVIGAGVVGLAVARELSLRGREVLILDAASSFGTVTSSRNSEVVHAGIYYPPNSLKA 139 +D VV+GAGVVGLAVARE++L G EVL+++A + G TSSRNSEV+HAGIYYPP SLKA Sbjct: 5 IDCVVVGAGVVGLAVAREMALAGHEVLVIEAGEAIGIGTSSRNSEVIHAGIYYPPGSLKA 64 Query: 140 KFCVRGRELLYKYCSEYEIPHKKIGKLIVATGSSEIPKLDLLMHLGTQNRVSGLRMLEGF 199 + CV GR LY YC + + +K GKLIVA +++ +L +L+ G N V LR+L+ Sbjct: 65 QLCVEGRHALYAYCDSHGVSTRKTGKLIVAKDEAQVRQLQVLLERGLVNGVEDLRLLDRE 124 Query: 200 EAMRMEPQLRCVKALLSPESGILDTHSFMLSLVEKSFDFMVYRDNNNLRLQGEAQNNHAT 259 +A+ +EP L C+ AL SP +GI+D+H ML+ LQG+A+ T Sbjct: 125 QALALEPALECIAALYSPSTGIVDSHGLMLA------------------LQGDAEAAGTT 166 Query: 260 FSYNTVVLNGRVEEKKMHLYVADTRFSESRCEAEAQLELIPNLVVNSAGLGAQALAKRLH 319 ++ + +++ RV L V A + L L++N+AGL A ALA+R+ Sbjct: 167 IAFYSPLISARVTADGFLLDVG----------GAAPMVLSCRLLINAAGLKAPALARRME 216 Query: 320 GLDHRFVPSSHYARGCYFTLSGIKAPPFNKLVYPIPEEGGLGVHVTVDLNGLVKFGPDVE 379 GL + VP + +G YF+L+ K PF L+YP PE GLGVH+T+DL G +FGPD E Sbjct: 217 GLAQQTVPRDYLCKGSYFSLA--KRAPFTHLIYPAPEAAGLGVHMTLDLGGQARFGPDTE 274 Query: 380 WIECTDDTSSFLNKFDYRVNPQRSEKFYPEIRKYYPDLKDGSLEPGYSGIRPKLSGPKQS 439 W+E DYRV+P R+ FY IR Y+PDL D SL+PGYSGIRPK+S P + Sbjct: 275 WVEAE----------DYRVDPSRANAFYAAIRSYWPDLPDNSLQPGYSGIRPKISAPGEP 324 Query: 440 PADFVIQGEETHGVPGLVNLFGIESPGLTSSLAIAEHI 477 +DF+I E H VPGL+NLFGIESPGLT+ LAIA+ + Sbjct: 325 ASDFLISSERLHNVPGLINLFGIESPGLTACLAIAKRV 362 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 368 Length adjustment: 32 Effective length of query: 451 Effective length of database: 336 Effective search space: 151536 Effective search space used: 151536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory