Align GABA permease; 4-amino butyrate transport carrier; Gamma-aminobutyrate permease; Proline transporter GabP (characterized)
to candidate AO356_28340 AO356_28340 GABA permease
Query= SwissProt::P46349 (469 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28340 Length = 466 Score = 421 bits (1082), Expect = e-122 Identities = 214/457 (46%), Positives = 299/457 (65%), Gaps = 4/457 (0%) Query: 4 SQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRML 63 S L + K RH+TM+SIAG+IGAGLFVGSG I + GP +++Y +GLLV+ +MRML Sbjct: 9 SNGHLAQGFKPRHVTMLSIAGIIGAGLFVGSGHAIAAAGPAVMLAYLFSGLLVVLVMRML 68 Query: 64 GEMSAVNPTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVIAIEAIAGAGIIQYWFHDIP 123 GEM+ NP +GSFS YA AIG WAGFTIGWLYW+FWV+VI IEA+A ++ WF + Sbjct: 69 GEMAVANPDTGSFSTYADQAIGRWAGFTIGWLYWWFWVLVIPIEALAAGHVLNQWFPAVD 128 Query: 124 LWLTSLILTIVLTLTNVYSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPVG 183 WL + + ++L +TN++SV +GEFE+WF++ KVV II F+ +GFA + G+ P E G Sbjct: 129 AWLFASVSIVLLAVTNLFSVSKYGEFEFWFAMAKVVAIIGFISLGFAVLMGWIPEREASG 188 Query: 184 FSNLTGK-GGFFPEGISSVLLGIVVVIFSFMGTEIVAIAAGETSNPIESVTKATRSVVWR 242 S L + GGF P G+S+V+ + ++FSF+GTE V IAA E+ NP +++ KATRSV+WR Sbjct: 189 LSRLMEEHGGFAPNGLSAVVGAFITIMFSFIGTEAVTIAAAESDNPAQNIAKATRSVIWR 248 Query: 243 IIVFYVGSIAIVVALLPWNSANILE-SPFVAVLEHIGVPAAAQIMNFIVLTAVLSCLNSG 301 I VFY+ SI +V++++PWN + + LE + +P A +++ +VL AV SC+NS Sbjct: 249 IGVFYLLSIFVVISVVPWNDPLLASVGSYQRALELMNIPHAKFLVDMVVLIAVASCMNSS 308 Query: 302 LYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNYFSPDTVFLFLV 361 +Y SRMLYSL R +AP+ S GVP A++A T + +YF P +F FL+ Sbjct: 309 IYIASRMLYSLGRRGDAPKALKVTSSAGVPRSAVIASTVLGAGVTLFSYFMPAGLFQFLL 368 Query: 362 NSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMAF 421 SSGAIALLVYLVIA+SQL+MR+ +++ N E L +MWLFP+LT+L I+ I L M Sbjct: 369 ASSGAIALLVYLVIAISQLRMRRMMQRQNIE-LPFRMWLFPWLTWLVIVFISAALAVMMI 427 Query: 422 IDSMRDELLLT-GVITGIVLISYLVFRKRKVSEKAAA 457 R E+ T G+ I I R E+ A+ Sbjct: 428 TPEHRSEVSTTLGLALIISFIGLATSRHAPQPERVAS 464 Lambda K H 0.326 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 640 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 466 Length adjustment: 33 Effective length of query: 436 Effective length of database: 433 Effective search space: 188788 Effective search space used: 188788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory