GapMind for catabolism of small carbon sources


Aligments for a candidate for acn in Pseudomonas fluorescens FW300-N2C3

Align Aconitate hydratase A; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC; EC (characterized)
to candidate AO356_20875 AO356_20875 Fe/S-dependent 2-methylisocitrate dehydratase AcnD

Query= SwissProt::Q937N8
         (869 letters)

>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20875 AO356_20875
           Fe/S-dependent 2-methylisocitrate dehydratase AcnD
          Length = 863

 Score = 1451 bits (3757), Expect = 0.0
 Identities = 732/868 (84%), Positives = 783/868 (90%), Gaps = 7/868 (0%)
















Lambda     K      H
   0.318    0.135    0.398 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2210
Number of extensions: 84
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 869
Length of database: 863
Length adjustment: 42
Effective length of query: 827
Effective length of database: 821
Effective search space:   678967
Effective search space used:   678967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

Align candidate AO356_20875 AO356_20875 (Fe/S-dependent 2-methylisocitrate dehydratase AcnD)
to HMM TIGR02333 (acnD: 2-methylisocitrate dehydratase, Fe/S-dependent (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02333.hmm
# target sequence database:        /tmp/gapView.6639.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02333  [M=858]
Accession:   TIGR02333
Description: 2met_isocit_dHY: 2-methylisocitrate dehydratase, Fe/S-dependent
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
          0 1826.9   0.0          0 1826.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20875  AO356_20875 Fe/S-dependent 2-met

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20875  AO356_20875 Fe/S-dependent 2-methylisocitrate dehydratase AcnD
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1826.7   0.0         0         0       1     858 []       2     858 ..       2     858 .. 1.00

  Alignments for each domain:
  == domain 1  score: 1826.7 bits;  conditional E-value: 0
                                       TIGR02333   1 ntkyrkalpgtdldyfdaraaveaikpgaydklpytsrvlaenlvrrvdpetleaslkqlier 63 
                                                     nt++rk+lpgt+ldyfd r av+ai+pgayd lpytsrvlaenlvrr+dp+tl +sl qlier
                                                     899************************************************************ PP

                                       TIGR02333  64 kreldfpwyparvvchdilgqtalvdlaglrdaiaekggdpaqvnpvvetqlivdhslaveyg 126
                                                     kr+ldfpw+parvvchdilgqtalvdlaglrdaia +ggdpaqvnpvv+tqlivdhslave g
                                                     *************************************************************** PP

                                       TIGR02333 127 gfdpdafeknraiedrrnedrfhfinwtkkafknvdvipagngimhqinlekmspvvqvkegv 189
                                                     g dp+af+knraiedrrnedrfhfinwtkkafknvdvip+gngimhqinlekmspv+q ++gv
                                                     *************************************************************** PP

                                       TIGR02333 190 afpdtlvgtdshtphvdalgviaigvggleaetvmlgraslmrlpdivgveltgkrqpgitat 252
                                                     afpdt+vgtdshtphvdalgviaigvggleae+vmlgras+mrlp+ivgveltgk qpgitat
                                                     *************************************************************** PP

                                       TIGR02333 253 divlalteflrkekvvsayleffgegakaltlgdratisnmtpeygataamfaideqtidylk 315
                                                     d+vlalteflrk+kvv+a+leffgega altlgdr tisnm+peygataamf id+qtidylk
                                                     *************************************************************** PP

                                       TIGR02333 316 ltgreeeqvklvetyakaaglwadslkkavyervlkfdlssvvrnlagpsnpharlatsdlaa 378
                                                     ltgre+ qv+lvetyak  glwadslk a+yer l+fdlssvvrn+agpsnphar+a s+laa
                                                     *************************************************************** PP

                                       TIGR02333 379 kgiakeveeeaeglmpdgaviiaaitsctntsnprnvvaagllarnanklglkrkpwvkssla 441
                                                     kgi++++++++ g+mpdgaviiaaitsctntsnprnv+aagllarnan+lgl rkpwvkssla
                                                     ***********.*************************************************** PP

                                       TIGR02333 442 pgskvvklyleeagllkeleklgfgivafacttcngmsgaldpviqqeiidrdlyatavlsgn 504
                                                     pgsk+v lyl+eagl +eleklgfg+vafacttcngmsgaldpviqqeiidrdlyatavlsgn
                                                     *************************************************************** PP

                                       TIGR02333 505 rnfdgrihpyakqaflaspplvvayaiagtirfdiekdvlgvdadgkeirlkdiwpsdeeida 567
                                                     rnfdgrihpyakqaflaspplvvayaiagtirfdiekdvlgv +dg+eirlkdiwpsdeeida
                                                     ******************************************.******************** PP

                                       TIGR02333 568 vvaaavkpeqfrkvyipmfdle.daqkkvsplydwrpmstyirrppywegalagertlkgmrp 629
                                                     vv+a+vkpeqfr+vyipmf+++ d++ kv+plydwrp+styirrppywegalag r lkgmrp
                                                     *********************989*************************************** PP

                                       TIGR02333 630 lavlgdnittdhlspsnailldsaageylakmglpeedfnsyathrgdhltaqratfanpklf 692
                                                     *************************************************************** PP

                                       TIGR02333 693 nemvkedgkvkqgslariepegkvtrmweaietymnrkqpliiiagadygqgssrdwaakgvr 755
                                                     *************************************************************** PP

                                       TIGR02333 756 lagveaivaegferihrtnlvgmgvlplefkpgtnrktlaldgtevydvvgeitpradltlvv 818
                                                     lagveai aegferihrtnlvgmgvlplefkpgt+rktl++dg+evydv+ge+tpra+ltlv+
                                                     *************************************************************** PP

                                       TIGR02333 819 trkngeklevpvtcrldtaeevsvyeaggvlqrfaqdfle 858
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20875 819 TRKNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLE 858
                                                     **************************************97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (858 nodes)
Target sequences:                          1  (863 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.02s 00:00:00.07 Elapsed: 00:00:00.06
# Mc/sec: 10.79

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory