GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Pseudomonas fluorescens FW300-N2C3

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate AO356_16045 AO356_16045 acetyl-CoA synthetase

Query= SwissProt::P27550
         (652 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_16045 AO356_16045
           acetyl-CoA synthetase
          Length = 645

 Score =  814 bits (2103), Expect = 0.0
 Identities = 385/629 (61%), Positives = 483/629 (76%), Gaps = 7/629 (1%)

Query: 19  INPQQYEAMYQQSINVPDTFWGEQG-KILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNL 77
           ++  +Y+ +Y++SI  P  FW EQ  + LDW+ P+Q V+      G+ +  W+  G LN+
Sbjct: 19  LSQDEYKRLYKESIEHPSAFWAEQATRFLDWMTPWQTVQRYDLKNGDAT--WFAGGKLNV 76

Query: 78  AANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAI 137
           +ANC+DRHL   G++ AIIWEGD+ ++S  I+YK+LH  VCR AN L   G+KKGD V I
Sbjct: 77  SANCIDRHLDTRGEQVAIIWEGDNPAESAQITYKKLHNHVCRLANVLKSRGVKKGDRVCI 136

Query: 138 YMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIP 197
           YMPM+PEAA AMLAC RIGAVHSV+FGGFSP+++  RI+D++ R VIT+DEGVR GR IP
Sbjct: 137 YMPMIPEAAYAMLACTRIGAVHSVVFGGFSPDSLRDRILDADCRTVITADEGVRGGRFIP 196

Query: 198 LKKNVDDALKN-PNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQASDQHQAEEMNAE 256
           LK+NVD AL++ PNV++V   +V++RT G++ W EGRDLW+H  +   SD    E M+AE
Sbjct: 197 LKRNVDKALESCPNVSTV---LVVERTQGEVGWVEGRDLWYHQAMHDMSDDCPPEPMDAE 253

Query: 257 DPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYL 316
           DPLFILYTSGSTGKPKGVLHTTGGYL+ AA+TFKYV DY   +++WCTADVGWVTGHSY+
Sbjct: 254 DPLFILYTSGSTGKPKGVLHTTGGYLLQAAMTFKYVLDYRDNEVFWCTADVGWVTGHSYI 313

Query: 317 LYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTD 376
           +YGPLA GATTL+FEGVP+ P+ +R  QV+DKHQVNI YTAPTA+RALM EG   ++ T 
Sbjct: 314 VYGPLANGATTLIFEGVPSHPSSSRFWQVIDKHQVNIFYTAPTALRALMREGAGPLQETS 373

Query: 377 RSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGS 436
           R SLR+LGSVGEPINPEAWEWY+  +G ++CP+VDTWWQTETGG M++PL  A  LK G 
Sbjct: 374 RKSLRLLGSVGEPINPEAWEWYFNVVGEQRCPIVDTWWQTETGGIMLSPLVSAPRLKPGC 433

Query: 437 ATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMY 496
           ATRP FGVQP L+D  G  + GA  G L I  SWPGQ R+++GDH+R   TYF  +   Y
Sbjct: 434 ATRPMFGVQPVLLDEVGKEISGAGSGVLAIKSSWPGQIRSVYGDHQRMVDTYFKPYPGYY 493

Query: 497 FSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKG 556
           F+GDGARRDEDG YWITGR+DDV+NVSGHR+GTAE+ESALV H  IAEAAVVG PH++KG
Sbjct: 494 FTGDGARRDEDGDYWITGRIDDVINVSGHRIGTAEVESALVLHDNIAEAAVVGYPHDLKG 553

Query: 557 QAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILR 616
           Q IYA+VT  +G E + EL  E+   V KEIG  A P+++ W  +LPKTRSGKIMRRILR
Sbjct: 554 QGIYAFVTPMNGVEANDELKKELLAHVSKEIGSFAKPELIQWAPALPKTRSGKIMRRILR 613

Query: 617 KIAAGDTSNLGDTSTLADPGVVEKLLEEK 645
           KIA  +  +LGDTSTLADP VVE L++++
Sbjct: 614 KIACNELDSLGDTSTLADPSVVEGLIDKR 642


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1388
Number of extensions: 53
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 645
Length adjustment: 38
Effective length of query: 614
Effective length of database: 607
Effective search space:   372698
Effective search space used:   372698
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory