GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Pseudomonas fluorescens FW300-N2C3

Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate AO356_29235 AO356_29235 acyl-CoA synthetase

Query= BRENDA::A4YDR9
         (549 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_29235 AO356_29235 acyl-CoA
           synthetase
          Length = 550

 Score =  382 bits (982), Expect = e-110
 Identities = 212/536 (39%), Positives = 314/536 (58%), Gaps = 7/536 (1%)

Query: 11  GVDPTGSWYSVLTPLLFLERAGKYFKDKTAVVYRDSRYTYSTFYDNVMVQASALMRRGFS 70
           G++ + + Y  LTPL FL+RA     D+ AVV+ D R T+    +     ASAL   G  
Sbjct: 9   GLEQSKANYLPLTPLGFLDRAALVHPDRVAVVHGDLRRTWRQTRERCYRLASALSNEGMG 68

Query: 71  REDKLSFISRNRPEFLESFFGVPYAGGVLVPINFRLSPKEMAYIINHSDSKFVVVDEPYL 130
             D +S +S N P  LE+ FGVP  G VL  +N+RL  + +A+I+ H + K ++VD  + 
Sbjct: 69  AGDTVSILSPNTPAMLEAHFGVPLCGAVLNTVNYRLDAEGVAFILRHGECKLLLVDREFA 128

Query: 131 NSLLEVKDQIKAEIILLEDPDNPSASETARKEVRMTYRELVKGGSRDPLPIPAKEEYSMI 190
              +   ++++   ++++  D+ +   ++  +V   Y   +  GS D   +   +E+  I
Sbjct: 129 ALAVAALERLEHPPVVIDINDHLAPLGSSIGDV--DYETFIGRGSPDFQGVWPSDEWQPI 186

Query: 191 TLYYTSGTTGLPKGVMHHHRGAFLNAMAEVLEHQMDLNSVYLWTLPMFHAASWGFSWATV 250
            L YTSGTTG PKGV+  HRG +L +M ++    +     YLWTLPMFHA  W F+WA  
Sbjct: 187 ALNYTSGTTGDPKGVVASHRGTYLMSMLQMTNWPLSRAPRYLWTLPMFHANGWCFTWAIT 246

Query: 251 AVGATNVCLDKVDYPLIYRLVEKERVTHMCAAPTVYVNLADYMKRNNLKFSNRVHMLVAG 310
           A   T+VCL KV    ++  ++ + V H CAAP V   +A+   R  L+   RV  L AG
Sbjct: 247 AAAGTHVCLRKVSAEAVFDAIDTQGVDHFCAAPIVMAMIANSADRPPLETPVRV--LTAG 304

Query: 311 AAPAPATLKAMQEIGGYMCHVYGLTETYGPHSICEWRREWDSLPLEEQAKLKARQGIPYV 370
           + P    L A+  +G  + HVYG+TE  G    C W+  W++L   +Q  L+ RQG    
Sbjct: 305 SPPPATVLDAVVSLGFDVDHVYGITEVSGTPISCVWQDGWNALAQSDQGALRVRQGARAA 364

Query: 371 SFE-MDVFDANG-KPVPWDGKTIGEVVMRGHNVALGYYKNPEKTAESFRDGWFHSGDAAV 428
            FE + V DA+  +PVP DG T GE++++G+ V +GY KN   T ++F  GWFH+GD AV
Sbjct: 365 GFEGLMVADADTLQPVPKDGHTTGELLLKGNTVMMGYLKNENATRKAFEGGWFHTGDVAV 424

Query: 429 VHPDGYIEIVDRFKDLINTGGEKVSSILVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARI 488
           VHP+GYI+I DR KD+I +GGE +SS+ +E+ +   P V   AV   PD+ WGEV  A I
Sbjct: 425 VHPNGYIQITDRCKDVIISGGENISSVEIEEAIHCHPAVLHAAVVAQPDDIWGEVPCAFI 484

Query: 489 ELQEGV-KLTEEEVIKFCKERLAHFECPKIVEFGPIPMTATGKMQKYVLRNEAKAK 543
           EL+ G  + TE ++I FC+ RLA F+CP+ V F  +P TATGK+QK++LR +A ++
Sbjct: 485 ELKGGAERPTEADMIAFCQARLARFKCPRRVIFMELPKTATGKIQKFLLREQAGSR 540


Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 677
Number of extensions: 30
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 549
Length of database: 550
Length adjustment: 36
Effective length of query: 513
Effective length of database: 514
Effective search space:   263682
Effective search space used:   263682
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory