Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate AO356_25715 AO356_25715 branched-chain amino acid ABC transporter substrate-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25715 Length = 383 Score = 269 bits (687), Expect = 1e-76 Identities = 162/378 (42%), Positives = 223/378 (58%), Gaps = 21/378 (5%) Query: 4 AIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLR 63 A+ P + K L L RNL K Y AVDD+SL I GE LG+SG GKST L Sbjct: 3 AVKDPAQQNNKTLVSL---RNLNKHYGDFAAVDDISLEIQDGEFLTFLGSSGSGKSTTLS 59 Query: 64 MLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPK 123 MLAGFE PS+G+I++ G L VPP+ R I M+FQ Y+LFPH++V NIAF L KL Sbjct: 60 MLAGFETPSSGEILVGGKSLVNVPPHKRDIGMVFQRYSLFPHLSVRDNIAFPLAIRKLAS 119 Query: 124 AEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKK 183 AE RV+ ML LV + EFA R+P QLSGGQ+QRVA+AR+L P++LL+DEP+GALDKK Sbjct: 120 AERERRVDAMLKLVQLGEFAHRRPSQLSGGQQQRVAIARALVYEPRILLMDEPLGALDKK 179 Query: 184 LRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTT 243 LR+ +Q E+ + R+G+T V VTHDQEEAM ++ RIAI + GK V +G ++Y++P Sbjct: 180 LREDLQDELRQLHRRLGITIVYVTHDQEEAMRLSQRIAIFSHGKIVGLGSGYDLYQNPPN 239 Query: 244 RYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIM 303 + A F+G+ N LK + + V G L + A + + V + +RPEK + Sbjct: 240 AFVASFLGNSN----FLKLKAQGNAVATFEG--QSLSIRLTAGLQTDQDVLLMVRPEKAL 293 Query: 304 ------LCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLP 357 +EP A G N +V+ + +LG+ V G ++ + +A G+P Sbjct: 294 ALSVEQAAQEPLAAGWNEVSAKVVEVLFLGESQTCSVVTSGGTAMTVKALSA----AGMP 349 Query: 358 -TWGDEVRLCW-EVDSCV 373 GD VR+ W D+CV Sbjct: 350 LKAGDPVRVRWATADACV 367 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 383 Length adjustment: 30 Effective length of query: 347 Effective length of database: 353 Effective search space: 122491 Effective search space used: 122491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory