Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate AO356_09105 AO356_09105 short-chain dehydrogenase
Query= SwissProt::A3LZU7 (258 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_09105 Length = 253 Score = 138 bits (348), Expect = 1e-37 Identities = 84/251 (33%), Positives = 137/251 (54%), Gaps = 8/251 (3%) Query: 8 KVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLTIPG 67 +V ITG +GIG+A+A+ AR+G V +LP++ ++ +++I L +P Sbjct: 4 RVALITGAASGIGQALAVAYARHGVAVAAGYLPADPHDP--QDTRQQIEALGGECLMLPL 61 Query: 68 DISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAFFAI 127 D++ + + E A FG ++ V+NAG+ LE++ E ++++L G Sbjct: 62 DVTDSRSVDNLAEQAFSTFGRLDYAVANAGLLRRAPLLEMSDEAWNAMLDVDLTGVMRTF 121 Query: 128 QAAAQQMVKQGKGGSIIGISSISALV-GGAHQTHYTPTKAGILSLMQSTACALGKYGIRC 186 +A+ + M +GG+++ ISSI+ V G +HY KAG+ L +S A L GIRC Sbjct: 122 RASVRYM---SEGGALVAISSIAGGVYGWPDHSHYAAAKAGVPGLCRSLAVELAGQGIRC 178 Query: 187 NAILPGTIST--ALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYVNG 244 NA++PG I T +L+ ++ PE IPLGRVG ++A FL SD S+Y+ G Sbjct: 179 NAVIPGLIETPQSLDSKNSLGPEGLAKAARAIPLGRVGRADEVASLVRFLTSDESSYLTG 238 Query: 245 AQLLVDGGLFV 255 +++DGGL V Sbjct: 239 QSIIIDGGLTV 249 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 253 Length adjustment: 24 Effective length of query: 234 Effective length of database: 229 Effective search space: 53586 Effective search space used: 53586 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory