GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rbsA in Pseudomonas fluorescens FW300-N2C3

Align ribose transport, ATP-binding protein RbsA; EC 3.6.3.17 (characterized)
to candidate AO356_23205 AO356_23205 D-ribose transporter ATP-binding protein

Query= CharProtDB::CH_003578
         (501 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_23205 AO356_23205 D-ribose
           transporter ATP-binding protein
          Length = 517

 Score =  468 bits (1205), Expect = e-136
 Identities = 241/491 (49%), Positives = 334/491 (68%), Gaps = 2/491 (0%)

Query: 4   LLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDAGTLLW 63
           LL++  + K FPGV ALS   L V PG V+AL+GENGAGKST+MK++ GIY  DAG L  
Sbjct: 26  LLEVVNVSKGFPGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKIIAGIYQPDAGELRL 85

Query: 64  LGKETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFVNRFGKIDWKTMYAEAD 123
            GK  TF  P ++ +AGI +IHQELNL+P ++IAENI++GRE +N    +D   M+    
Sbjct: 86  RGKPVTFDTPLAALQAGIAMIHQELNLMPHMSIAENIWIGREQLNGLHMVDHGEMHRCTA 145

Query: 124 KLLAKLNLRFKSDKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFRV 183
           +LL +L ++   ++ VG+LSI ++QMVEIAK +S++S ++IMDEPT A+T+TE   LF +
Sbjct: 146 RLLERLRIKLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITETEVAHLFSI 205

Query: 184 IRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLTEDSLIEMMVGRKLE 243
           I +LKSQG+GI+YI+H+M E+F I D+V VFRDG +I  +   S+  DSLI MMVGR+L 
Sbjct: 206 IADLKSQGKGIIYITHKMNEVFAIADEVAVFRDGAYIGLQRADSMDGDSLISMMVGRELS 265

Query: 244 DQYPHLDKAPGDIRLKVDNLCGPGV-NDVSFTLRKGEILGVSGLMGAGRTELMKVLYGAL 302
             +P  ++  G++ L V +L   G+   VSF L  GEILG++GLMG+GRT + + ++G  
Sbjct: 266 QLFPVREQPIGELVLSVRDLSLDGIFKGVSFDLHAGEILGIAGLMGSGRTNVAEAIFGVT 325

Query: 303 PRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRA 362
           P T G + LDG  V    P   +  G   ++EDRK  GL   +SV ENM +  L ++   
Sbjct: 326 PSTGGEIRLDGQPVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLENMEMAVLPHYV-G 384

Query: 363 GGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEP 422
            G ++    +    D  +   VKTPS+EQ I  LSGGNQQK  +AR LMT P++LILDEP
Sbjct: 385 NGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWLMTNPRILILDEP 444

Query: 423 TRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHLSGEFTREQA 482
           TRG+DVGAK EIY+LI+   ++G+++I++SSE+PEVLGMSDR++VMHEG L G   R +A
Sbjct: 445 TRGIDVGAKAEIYRLISYLASEGMAVIMISSELPEVLGMSDRVMVMHEGDLMGTLDRSEA 504

Query: 483 TQEVLMAAAVG 493
           TQE +M  A G
Sbjct: 505 TQERVMQLASG 515



 Score = 86.3 bits (212), Expect = 2e-21
 Identities = 63/232 (27%), Positives = 109/232 (46%), Gaps = 9/232 (3%)

Query: 266 PGV---NDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQ 322
           PGV   +DV   +R G +L + G  GAG++ LMK++ G     +G + L G  V   +P 
Sbjct: 37  PGVVALSDVQLRVRPGSVLALMGENGAGKSTLMKIIAGIYQPDAGELRLRGKPVTFDTPL 96

Query: 323 DGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYFSRAGGSLKHADEQQAVSDFIRLF 382
             L  GI  I ++     L+  MS+ EN+ +   R        + H +  +  +  +   
Sbjct: 97  AALQAGIAMIHQELN---LMPHMSIAENIWIG--REQLNGLHMVDHGEMHRCTARLLERL 151

Query: 383 NVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFK 442
            +K    EQ +G LS   +Q V IA+ +     +LI+DEPT  +       ++ +I   K
Sbjct: 152 RIKLDPEEQ-VGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITETEVAHLFSIIADLK 210

Query: 443 ADGLSIILVSSEMPEVLGMSDRIIVMHEGHLSGEFTREQATQEVLMAAAVGK 494
           + G  II ++ +M EV  ++D + V  +G   G    +    + L++  VG+
Sbjct: 211 SQGKGIIYITHKMNEVFAIADEVAVFRDGAYIGLQRADSMDGDSLISMMVGR 262


Lambda     K      H
   0.318    0.137    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 665
Number of extensions: 35
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 501
Length of database: 517
Length adjustment: 34
Effective length of query: 467
Effective length of database: 483
Effective search space:   225561
Effective search space used:   225561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory