Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family (characterized, see rationale)
to candidate AO356_28515 AO356_28515 sugar ABC transporter permease
Query= uniprot:A0A1N7UNQ5 (325 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28515 Length = 378 Score = 120 bits (301), Expect = 5e-32 Identities = 99/347 (28%), Positives = 160/347 (46%), Gaps = 66/347 (19%) Query: 41 FLSYDTFSTLANQIPDLMVLAVGMTFILIIGGIDLSVGSVLALAASAVSVA--------- 91 F++ S L Q+ +LA GM ++I G IDLSVGS+L L ++ Sbjct: 35 FVTPRNLSNLLRQMSITGILACGMVLVIISGEIDLSVGSLLGLLGGLAAILDVVYHVPLL 94 Query: 92 -----------ILGWG------WSVLPAAVLGMG-CAALAGT---ITGSITVAWRIPSFI 130 ++G G + +P+ ++G+G A G +TG T+A P + Sbjct: 95 ANLSLVALCGLVIGLGNGYMTAYLRIPSFIVGLGGMLAFRGVLLGVTGGTTIAPVSPELV 154 Query: 131 ------------VSLGVLEMARGV----------------AYQMTGS--RTAYIGD---S 157 LG+L A + A+ + R IG Sbjct: 155 YVGQGYLPHTVGTGLGILLFALTLFLTWKQRRNRALHGLAAHSLVRDVLRVVVIGAVLAG 214 Query: 158 FAWLSNPIAFGISPSFIIALLVIIAAQLVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYK 217 F + N GI ++ L+++ V ++TVFGR + +G+N EA RL+GIN + K Sbjct: 215 FVYTLNSYD-GIPVPVLLLLILLGVFSYVTSQTVFGRRVYSVGSNMEATRLSGINVQAVK 273 Query: 218 ILVFSLMGLLAGVAALFQISRLEAADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFF 277 + +F +MG++ +A + +RL A P+AG+ EL IAA IGGTS+ GG G+V Sbjct: 274 LWIFGIMGVMCALAGVVNTARLAAGSPSAGNMGELDAIAACFIGGTSMRGGSGTVYGALL 333 Query: 278 GVLIISVLAAGLAQIGATEPTKRIITGAVIVIAVVLDTYRSQRASRR 324 G L+I+ L G++ + + I+ G+++V+AV +D S R RR Sbjct: 334 GALVITSLDNGMSMLDVDSYWQMIVKGSILVLAVWVDV--STRTGRR 378 Lambda K H 0.324 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 325 Length of database: 378 Length adjustment: 29 Effective length of query: 296 Effective length of database: 349 Effective search space: 103304 Effective search space used: 103304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory