Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate AO356_28370 AO356_28370 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28370 Length = 265 Score = 186 bits (473), Expect = 3e-52 Identities = 108/245 (44%), Positives = 157/245 (64%), Gaps = 8/245 (3%) Query: 5 SNKVLLQVKGLKVAYGG-IQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMND 63 +N +LQ+ ++V Y I AV+ V EV +G++V L+G+NGAGK+TT+KA + + Sbjct: 3 TNVPILQIDDIEVLYEQTILAVRSVSLEVEKGQVVVLLGANGAGKSTTLKAASNLVRAER 62 Query: 64 GN-----IEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRK-DKAG 117 G I Y GK + L GLV V EGR FA++T+ ENL GA R+ + Sbjct: 63 GEVVRGRIVYQGKDVTRSAPHTLAASGLVQVLEGRHCFAQLTVEENLLAGALARQVPRRQ 122 Query: 118 ILADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIM 177 +LAD+E ++ FPRL+ R+ LAG SGGEQQM+A+GRALM++P+++LLDEPSMGL+P + Sbjct: 123 LLADLELVYGHFPRLKLRRKSLAGYTSGGEQQMIAIGRALMARPQLVLLDEPSMGLAPQI 182 Query: 178 VDKIFEVVRDVYAL-GVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVR 236 V++IFE+VR + GV+ ++ EQN + AL A GYV+ESG + G +QL ++ Sbjct: 183 VEEIFEIVRQLNQRDGVSFLIAEQNINVALRYAHHGYVLESGRVVSEGSAEQLAARSDLQ 242 Query: 237 AAYLG 241 YLG Sbjct: 243 DFYLG 247 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 265 Length adjustment: 24 Effective length of query: 218 Effective length of database: 241 Effective search space: 52538 Effective search space used: 52538 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory