Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate AO356_28995 AO356_28995 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28995 Length = 258 Score = 187 bits (474), Expect = 2e-52 Identities = 107/249 (42%), Positives = 162/249 (65%), Gaps = 8/249 (3%) Query: 1 MAEKSNKVLLQVKGLKVAY-GGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTL 59 +A + LL V+ ++V Y G I AV GV V +G++V+L+G+NGAGK+TT+KAI+G + Sbjct: 6 LAGAESSELLAVQDIEVIYDGAILAVAGVSLRVGQGDIVALLGANGAGKSTTLKAISGLV 65 Query: 60 S-----MNDGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKD 114 ++ G I + G+ G A L + G+V V EGR VFA +TI +NL+ G ++RK Sbjct: 66 QADRAQVSRGRIVFQGQDTAGVAANLLARRGIVHVLEGRHVFAHLTIEDNLRSGGFLRKP 125 Query: 115 KAGILA-DIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGL 173 L D+E+++ FPRL+ ++ AG SGGEQQMLA+GRALM+QP+++LLDEPSMGL Sbjct: 126 TRRELEHDLERIYAWFPRLKTKRKTQAGLTSGGEQQMLAIGRALMTQPRLVLLDEPSMGL 185 Query: 174 SPIMVDKIFEVVRDVYAL-GVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLND 232 +PI+V++IF +V + A GV+ ++ EQN + AL A Y++E+G + G +L Sbjct: 186 APILVEEIFAIVAQLNAQEGVSFLVAEQNINVALRHASYAYILENGRVVGEGDATELAAR 245 Query: 233 PKVRAAYLG 241 ++ YLG Sbjct: 246 EDLQHFYLG 254 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 258 Length adjustment: 24 Effective length of query: 218 Effective length of database: 234 Effective search space: 51012 Effective search space used: 51012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory