GapMind for catabolism of small carbon sources

 

Aligments for a candidate for sdaB in Pseudomonas fluorescens FW300-N2C3

Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate AO356_13820 AO356_13820 serine dehydratase

Query= reanno::pseudo3_N2E3:AO353_15500
         (458 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 AO356_13820 serine
           dehydratase
          Length = 458

 Score =  714 bits (1842), Expect = 0.0
 Identities = 354/458 (77%), Positives = 398/458 (86%)

Query: 1   MAISVFDLFKVGIGPSSSHTVGPMRAAATFAQALFDQGLLEQTRRVEVRLYGSLSATGVG 60
           MAISVFDLFK+GIGPSSSHTVGPMRAAA F +AL  + LL   RRVEV+L+GSLSATG+G
Sbjct: 1   MAISVFDLFKIGIGPSSSHTVGPMRAAALFVEALKAKALLNDVRRVEVQLFGSLSATGIG 60

Query: 61  HATDRACVMGLMGEWPDSIDPSCIGPRIQQLRESGELLLAGRRSIAFDWQRDLLLLDESL 120
           H +D A +MGLMGEWPD+IDPS IGPRI+ LRE+  LLL GR  + F W RD+ L+DE+L
Sbjct: 61  HGSDNAVIMGLMGEWPDAIDPSQIGPRIELLRETQTLLLDGRLPVPFVWSRDMRLIDENL 120

Query: 121 PYHPNAMSLTAFGESGQLWEQTYYSVGGGFIVEAAEAESGVPASSDVVLPYEFSSAVELL 180
           P+HPNAM+L A G  G+L   TYYSVGGGF+V+ A+A SGV       LPY+FSSA ELL
Sbjct: 121 PFHPNAMTLVAEGADGELHRDTYYSVGGGFVVDQAQASSGVVDLDSTELPYDFSSAEELL 180

Query: 181 SLCNQHGLRVSELMMANERAWRSDAEIRSGLLHIWSVMRECVEQGLRHEGILPGGLDVPR 240
            LC  H LRV+ELM++NE+ WRS+ EIRSGL+ +W  M++CVEQGL+HEGILPGGL+V R
Sbjct: 181 ELCRTHNLRVAELMLSNEKVWRSEEEIRSGLMKLWRAMQDCVEQGLKHEGILPGGLNVRR 240

Query: 241 RAAKLHRSLLEIGKPNVISSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV 300
           RAAKLHRSL E+ KPNVI STLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV
Sbjct: 241 RAAKLHRSLQELNKPNVIGSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV 300

Query: 301 LHYYMKFNPDASDDDVVAFFLAAASVGILCKKNASISGAEVGCQGEVGSACAMAAAGLAD 360
           LHY+MKF+   +D +VV +FLAAA++GILCKKNASISGAEVGCQGEVGSACAMAAAGLA+
Sbjct: 301 LHYFMKFSEAVTDANVVDYFLAAAAIGILCKKNASISGAEVGCQGEVGSACAMAAAGLAE 360

Query: 361 VLGATPEQLENAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINATQMALRGDGK 420
           +LGATPEQL NAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINA QMALRGDG+
Sbjct: 361 ILGATPEQLCNAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINAAQMALRGDGQ 420

Query: 421 HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVSWVEC 458
           HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVS VEC
Sbjct: 421 HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVSAVEC 458


Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 657
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 458
Length of database: 458
Length adjustment: 33
Effective length of query: 425
Effective length of database: 425
Effective search space:   180625
Effective search space used:   180625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate AO356_13820 AO356_13820 (serine dehydratase)
to HMM TIGR00720 (L-serine ammonia-lyase (EC 4.3.1.17))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00720.hmm
# target sequence database:        /tmp/gapView.2032.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00720  [M=450]
Accession:   TIGR00720
Description: sda_mono: L-serine ammonia-lyase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   2.5e-213  694.9   0.0   2.9e-213  694.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820  AO356_13820 serine dehydratase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820  AO356_13820 serine dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  694.7   0.0  2.9e-213  2.9e-213       1     449 [.       3     454 ..       3     455 .. 0.98

  Alignments for each domain:
  == domain 1  score: 694.7 bits;  conditional E-value: 2.9e-213
                                       TIGR00720   1 isvfdlfkiGiGPssshtvGPmkaakefveelkkkgkleqvkrvkvdlyGslaltGkGhktdk 63 
                                                     isvfdlfkiGiGPssshtvGPm+aa+ fve+lk k+ l++v+rv+v+l+Gsl++tG Gh++d+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820   3 ISVFDLFKIGIGPSSSHTVGPMRAAALFVEALKAKALLNDVRRVEVQLFGSLSATGIGHGSDN 65 
                                                     79************************************************************* PP

                                       TIGR00720  64 avllGleGelpeevdiesieklleeveeekklklanqkeikfdlekdlafkdevlplhenglr 126
                                                     av++Gl+Ge p+ +d  +i  ++e ++e+++l l ++  + f  ++d+++ de+lp+h+n+++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820  66 AVIMGLMGEWPDAIDPSQIGPRIELLRETQTLLLDGRLPVPFVWSRDMRLIDENLPFHPNAMT 128
                                                     *************************************************************** PP

                                       TIGR00720 127 lkaydeegevlkektyysvGGGfivdeeelkkeeeeee..evpypfksaaellelCkeeglsi 187
                                                     l a   +   l+++tyysvGGGf+vd++++++   + +  e+py+f+sa+ellelC++++l +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 129 LVAEGAD-GELHRDTYYSVGGGFVVDQAQASSGVVDLDstELPYDFSSAEELLELCRTHNLRV 190
                                                     *998888.6799***************99998877655569********************** PP

                                       TIGR00720 188 sevvlenekalrseeevraklleiwkvmeecierglkaegvlpGglkvkrraaslkrklkake 250
                                                     +e++l+nek++rseee+r+ l+++w++m++c+e+glk+eg+lpGgl+v+rraa+l+r l++ +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 191 AELMLSNEKVWRSEEEIRSGLMKLWRAMQDCVEQGLKHEGILPGGLNVRRRAAKLHRSLQELN 253
                                                     *************************************************************99 PP

                                       TIGR00720 251 ets..kdplavldwvnlyalavneenaaGgrvvtaPtnGaagiiPavlayykkfveeaseekv 311
                                                     + +   ++l++++wvnl+alavneenaaGgr+vtaPtnGaagiiPavl+y+ kf e +++ +v
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 254 KPNviGSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAVLHYFMKFSEAVTDANV 316
                                                     99877899******************************************************* PP

                                       TIGR00720 312 vrflltagaiGilykenasisgaevGCqgevGvacsmaaaglaellggtpeqvenaaeiameh 374
                                                     v+++l+a+aiGil+k+nasisgaevGCqgevG+ac+maaaglae+lg+tpeq++naaei++eh
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 317 VDYFLAAAAIGILCKKNASISGAEVGCQGEVGSACAMAAAGLAEILGATPEQLCNAAEIGLEH 379
                                                     *************************************************************** PP

                                       TIGR00720 375 nlGltCdPvgGlvqiPCiernaiaavkainaarlalkedgkkkvsldkvietmretGkdmkak 437
                                                     nlGltCdPvgGlvq+PCiernaiaavkainaa++al++dg++++sld+vi+tmr+tG+dm+ k
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 380 NLGLTCDPVGGLVQVPCIERNAIAAVKAINAAQMALRGDGQHFISLDRVIRTMRDTGADMHDK 442
                                                     *************************************************************** PP

                                       TIGR00720 438 yketskgGlavk 449
                                                     ykets+gGlav+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13820 443 YKETSRGGLAVS 454
                                                     **********95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (450 nodes)
Target sequences:                          1  (458 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.40
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory