GapMind for catabolism of small carbon sources

 

Aligments for a candidate for sdaB in Pseudomonas fluorescens FW300-N2C3

Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate AO356_18165 AO356_18165 serine dehydratase

Query= reanno::pseudo6_N2E2:Pf6N2E2_5557
         (458 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 AO356_18165 serine
           dehydratase
          Length = 458

 Score =  889 bits (2298), Expect = 0.0
 Identities = 447/458 (97%), Positives = 452/458 (98%)

Query: 1   MSLSVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDDLLNCTTSVKVELYGSLGATGKG 60
           MSLSVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDDLL   TSVKVELYGSLGATGKG
Sbjct: 1   MSLSVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDDLLESITSVKVELYGSLGATGKG 60

Query: 61  HGSDKAVLLGLEGEHPDTVDTETVDARLQAIRSSGRLNLLGEHSIEFNEKLHLAMIRKPL 120
           HGSDKAVLLGLEGEHPDTVDTETV+ARLQ IRS+GRLNLLG H+IEFNEKLHLAMIRKPL
Sbjct: 61  HGSDKAVLLGLEGEHPDTVDTETVNARLQEIRSNGRLNLLGAHAIEFNEKLHLAMIRKPL 120

Query: 121 AFHPNGMIFRAFDAAGLQVRSREYYSVGGGFVVDEGAAGADRIVEDATPLTFPFKSAKDL 180
           AFHPNGMIFRAFDAAGLQVRSREYYSVGGGFVVDE AAGADRIVEDATPLTFPFKSAKDL
Sbjct: 121 AFHPNGMIFRAFDAAGLQVRSREYYSVGGGFVVDEDAAGADRIVEDATPLTFPFKSAKDL 180

Query: 181 LGHCSTYGLSISQVMLTNESAWRPEAETRAGLLKIWQVMQDCVAAGCRNEGILPGGLKVK 240
           LGHC+TYGLSISQVMLTNESAWRPEAETRAGLLKIWQVMQDCVAAGCRNEGILPGGLKVK
Sbjct: 181 LGHCTTYGLSISQVMLTNESAWRPEAETRAGLLKIWQVMQDCVAAGCRNEGILPGGLKVK 240

Query: 241 RRAAALHRQLCKNPEAALRDPLSVLDWVNLYALAVNEENAYGGRVVTAPTNGAAGIIPAV 300
           RRAAALHRQLCKNPEAALRDPLSVLDWVNLYALAVNEENAYGGRVVTAPTNGAAGIIPAV
Sbjct: 241 RRAAALHRQLCKNPEAALRDPLSVLDWVNLYALAVNEENAYGGRVVTAPTNGAAGIIPAV 300

Query: 301 LHYYMRFIPGASEDGVVRFLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGALCE 360
           LHYYMRFIPGASEDGVVRFLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGALCE
Sbjct: 301 LHYYMRFIPGASEDGVVRFLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGALCE 360

Query: 361 VLGGSVQQVENAAEIGMEHNLGLTCDPIGGLVQVPCIERNAMGSVKAINAVRMAMRGDGH 420
           VLGG+VQQVENAAEIGMEHNLGLTCDPIGGLVQVPCIERNAMGSVKAINAVRMAMRGDGH
Sbjct: 361 VLGGTVQQVENAAEIGMEHNLGLTCDPIGGLVQVPCIERNAMGSVKAINAVRMAMRGDGH 420

Query: 421 HFVSLDKVIRTMRQTGADMKSKYKETARGGLAVNIIEC 458
           HFVSLDKVIRTMRQTGADMKSKYKETARGGLAVNIIEC
Sbjct: 421 HFVSLDKVIRTMRQTGADMKSKYKETARGGLAVNIIEC 458


Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 882
Number of extensions: 28
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 458
Length of database: 458
Length adjustment: 33
Effective length of query: 425
Effective length of database: 425
Effective search space:   180625
Effective search space used:   180625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate AO356_18165 AO356_18165 (serine dehydratase)
to HMM TIGR00720 (L-serine ammonia-lyase (EC 4.3.1.17))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00720.hmm
# target sequence database:        /tmp/gapView.6858.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00720  [M=450]
Accession:   TIGR00720
Description: sda_mono: L-serine ammonia-lyase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   1.1e-221  722.4   0.1   1.3e-221  722.2   0.1    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165  AO356_18165 serine dehydratase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165  AO356_18165 serine dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  722.2   0.1  1.3e-221  1.3e-221       2     450 .]       4     455 ..       3     455 .. 0.99

  Alignments for each domain:
  == domain 1  score: 722.2 bits;  conditional E-value: 1.3e-221
                                       TIGR00720   2 svfdlfkiGiGPssshtvGPmkaakefveelkkkgkleqvkrvkvdlyGslaltGkGhktdka 64 
                                                     svfdlfkiGiGPssshtvGPm+aa++f+e l++ + le++++vkv+lyGsl++tGkGh++dka
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165   4 SVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDDLLESITSVKVELYGSLGATGKGHGSDKA 66 
                                                     9************************************************************** PP

                                       TIGR00720  65 vllGleGelpeevdiesieklleeveeekklklanqkeikfdlekdlafkdevlplhenglrl 127
                                                     vllGleGe+p++vd+e+++++l+e++++++l+l++ + i+f+++ +la+ ++ l +h+ng+ +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165  67 VLLGLEGEHPDTVDTETVNARLQEIRSNGRLNLLGAHAIEFNEKLHLAMIRKPLAFHPNGMIF 129
                                                     *************************************************************** PP

                                       TIGR00720 128 kaydeegevlkektyysvGGGfivdeeelkkeeeeee..evpypfksaaellelCkeeglsis 188
                                                     +a+d +g ++++++yysvGGGf+vde++++ ++  e+   +++pfksa++ll +C++ glsis
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 130 RAFDAAGLQVRSREYYSVGGGFVVDEDAAGADRIVEDatPLTFPFKSAKDLLGHCTTYGLSIS 192
                                                     ***************************9998876666347889******************** PP

                                       TIGR00720 189 evvlenekalrseeevraklleiwkvmeecierglkaegvlpGglkvkrraaslkrklkakee 251
                                                     +v+l+ne a+r+e+e+ra ll+iw+vm++c+  g+++eg+lpGglkvkrraa+l+r+l ++ e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 193 QVMLTNESAWRPEAETRAGLLKIWQVMQDCVAAGCRNEGILPGGLKVKRRAAALHRQLCKNPE 255
                                                     *************************************************************99 PP

                                       TIGR00720 252 ts.kdplavldwvnlyalavneenaaGgrvvtaPtnGaagiiPavlayykkfveeaseekvvr 313
                                                     +  +dpl+vldwvnlyalavneena GgrvvtaPtnGaagiiPavl+yy +f++ ase+ vvr
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 256 AAlRDPLSVLDWVNLYALAVNEENAYGGRVVTAPTNGAAGIIPAVLHYYMRFIPGASEDGVVR 318
                                                     999************************************************************ PP

                                       TIGR00720 314 flltagaiGilykenasisgaevGCqgevGvacsmaaaglaellggtpeqvenaaeiamehnl 376
                                                     fllta+aiGilykenasisgaevGCqgevGvacsmaa++l+e+lggt++qvenaaei+mehnl
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 319 FLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGALCEVLGGTVQQVENAAEIGMEHNL 381
                                                     *************************************************************** PP

                                       TIGR00720 377 GltCdPvgGlvqiPCiernaiaavkainaarlalkedgkkkvsldkvietmretGkdmkakyk 439
                                                     GltCdP+gGlvq+PCierna+++vkaina r+a+++dg+++vsldkvi+tmr+tG+dmk+kyk
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 382 GLTCDPIGGLVQVPCIERNAMGSVKAINAVRMAMRGDGHHFVSLDKVIRTMRQTGADMKSKYK 444
                                                     *************************************************************** PP

                                       TIGR00720 440 etskgGlavkv 450
                                                     et++gGlav++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_18165 445 ETARGGLAVNI 455
                                                     *********96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (450 nodes)
Target sequences:                          1  (458 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 9.38
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory