Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate AO356_13705 AO356_13705 fructose-1,6-bisphosphate aldolase
Query= BRENDA::Q602L6 (354 letters) >lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 AO356_13705 fructose-1,6-bisphosphate aldolase Length = 354 Score = 524 bits (1349), Expect = e-153 Identities = 258/350 (73%), Positives = 292/350 (83%) Query: 1 MALISLRQLLDHAAEHGYGLPAFNVNNMEQIKAIMEAASAVDAPVILQGSAGARTYAGEP 60 MALIS+RQ+LDHAAE GYG+PAFNVNN+EQ++AIMEAA D+PVI+Q SAGAR YAG P Sbjct: 1 MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP 60 Query: 61 FLRHLVRAAIEMYPHIPVCMHQDHGASPAVCIRSIQSGFSSVMMDGSLLEDMKTPASYAY 120 FLRHL+ AAIE +PHIPVCMHQDHG SP VC RSIQ GFSSVMMDGSL ED KTP Y Y Sbjct: 61 FLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGEDGKTPTDYEY 120 Query: 121 NVETTRKVVEMAHACGVSVEGELGCLGSLETGRAGKEDGHGAEGELDHSLLLTDPDEAAD 180 NV T++ V MAHACGVSVEGELGCLGSLETG AG+EDG GAEG LDHS +LTDP+EAAD Sbjct: 121 NVRVTQQTVAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAEGVLDHSQMLTDPEEAAD 180 Query: 181 FVRQTQVDALAIAIGTSHGAYKFTRKPTGQVLRIDRVKAIHQRIPTIHLVMHGSSSVPEE 240 FV++TQVDALAIAIGTSHGAYKFT+ PTG VL IDR+K IH+RIP HLVMHGSSSVP+E Sbjct: 181 FVKKTQVDALAIAIGTSHGAYKFTKPPTGDVLAIDRIKEIHKRIPNTHLVMHGSSSVPQE 240 Query: 241 WAQMINDYGGDIGQTYGVPVEEIVEGIRHGVRKVNIDTDLRIASYGAMRRFMVEDRKNFD 300 W +IN YGGDI +TYGVPVEEIVEGI++GVRKVNIDTDLR+AS GAMRR M + FD Sbjct: 241 WLAIINQYGGDIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAMRRLMATNPSEFD 300 Query: 301 PRKLYKAAQTAMTAICRARYEAFGAAGQAAKIKPLRLEDMSLAYAQGKLD 350 PRK + A TAM +C ARYEAFG AG A+KIKP+ LE M Y +G+L+ Sbjct: 301 PRKFFGATVTAMRDVCIARYEAFGTAGNASKIKPISLEAMYQRYLKGELN 350 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 354 Length adjustment: 29 Effective length of query: 325 Effective length of database: 325 Effective search space: 105625 Effective search space used: 105625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate AO356_13705 AO356_13705 (fructose-1,6-bisphosphate aldolase)
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01521.hmm # target sequence database: /tmp/gapView.29634.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01521 [M=347] Accession: TIGR01521 Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-214 697.9 0.2 1.3e-214 697.7 0.2 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 AO356_13705 fructose-1,6-bisphos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 AO356_13705 fructose-1,6-bisphosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 697.7 0.2 1.3e-214 1.3e-214 1 347 [] 3 349 .. 3 349 .. 1.00 Alignments for each domain: == domain 1 score: 697.7 bits; conditional E-value: 1.3e-214 TIGR01521 1 lislrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrkl 63 lis+rq+ldhaae+gygvpafnvnnleq++aimeaadktdspvi+qas+gar+yag+++lr+l lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 3 LISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAPFLRHL 65 69************************************************************* PP TIGR01521 64 vlaaveeypdipvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaev 126 +laa+ee+p+ipv++hqdhg+sp++c+++iqlgf+svmmdgsl ed+ktp+dy+ynv+vt+++ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 66 ILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGEDGKTPTDYEYNVRVTQQT 128 *************************************************************** PP TIGR01521 127 vklahavgasvegelgclgsletgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdala 189 v++aha+g+svegelgclgsletg++++edg g+eg+ld+sq+ltdpeeaa+fvkkt+vdala lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 129 VAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAEGVLDHSQMLTDPEEAADFVKKTQVDALA 191 *************************************************************** PP TIGR01521 190 vaigtshgaykftrkptgevlaidrieeiherlpdthlvmhgsssvpqewldvineyggeike 252 +aigtshgaykft++ptg+vlaidri+eih+r+p+thlvmhgsssvpqewl++in+ygg+ike lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 192 IAIGTSHGAYKFTKPPTGDVLAIDRIKEIHKRIPNTHLVMHGSSSVPQEWLAIINQYGGDIKE 254 *************************************************************** PP TIGR01521 253 tygvpveeivkgikfgvrkvnidtdlrlaataalrrvaakdpsefdprkflkkaveamkdvck 315 tygvpveeiv+gik+gvrkvnidtdlrla+t+a+rr++a++psefdprkf+ +v am+dvc+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 255 TYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAMRRLMATNPSEFDPRKFFGATVTAMRDVCI 317 *************************************************************** PP TIGR01521 316 aryeafgtagnaskikvvsleemarryakgel 347 aryeafgtagnaskik++sle m++ry kgel lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_13705 318 ARYEAFGTAGNASKIKPISLEAMYQRYLKGEL 349 ******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (347 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory