GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruK in Pseudomonas fluorescens FW300-N2C3

Align Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized)
to candidate AO356_20250 AO356_20250 L-arabinose transporter ATP-binding protein

Query= SwissProt::Q8G847
         (513 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_20250 AO356_20250
           L-arabinose transporter ATP-binding protein
          Length = 514

 Score =  314 bits (805), Expect = 4e-90
 Identities = 178/482 (36%), Positives = 290/482 (60%), Gaps = 12/482 (2%)

Query: 12  GITIEFPGVKALDGVDLTLYPGEVHALMGENGAGKSTMIKALTGVYKINAGSIMVDGKPQ 71
           GI   FPGV+AL  +    +PG+VHALMGENGAGKST++K L G Y  ++G + +  +  
Sbjct: 20  GIGKSFPGVQALANISFVAHPGQVHALMGENGAGKSTLLKILGGAYIPSSGDLQIGEQTM 79

Query: 72  QFNGTLDAQNAGIATVYQEVNLCTNLSVGENVMLGHEKRGPFGIDWKKTHEAAKKYLAQM 131
            F GT D+  +G+A ++QE++L   ++V EN+ LGH     FG+  +         L + 
Sbjct: 80  AFKGTADSIASGVAVIHQELHLVPEMTVAENLFLGHLP-ARFGLVNRGVLRQQALTLLKG 138

Query: 132 GLESIDPHTPLSSISIAMQQLVAIARAMVINAKVLILDEPTSSLDANEVRDLFAIMRKVR 191
             + IDP   +  +S+  +QLV IA+A+   A V+  DEPTSSL A E+  L AI+ ++R
Sbjct: 139 LADEIDPQEKVGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRLMAIIARLR 198

Query: 192 DSGVAILFVSHFLDQIYEITDRLTILRNGQFIK--EVMTKDTPRDELIGMMIGKSAAELS 249
           D G  +L+VSH +++++ I + +T+ ++G++++  E M++ T  D+L+  M+G+   ++ 
Sbjct: 199 DEGKVVLYVSHRMEEVFRICNAVTVFKDGRYVRTFENMSELT-HDQLVTCMVGRDIQDIY 257

Query: 250 QIGAKKARREITPGEKPIVDVKGLGKKGTINPVDVDIYKGEVVGFAGLLGSGRTELGRLL 309
               ++ R ++       + VK L   G   PV   ++KGE++G  GL+G+GRTEL RLL
Sbjct: 258 DYRPRE-RGDVA------LQVKSLLGPGLREPVSFQVHKGEILGLFGLVGAGRTELFRLL 310

Query: 310 YGADKPDSGTYTLNGKKVNISDPYTALKNKIAYSTENRRDEGIIGDLTVRQNILIALQAT 369
            G ++   G+  L+GK++ +  P  A+   +    E+R+ EGII   +V +NI I+ +  
Sbjct: 311 SGLERQSEGSLVLHGKELKLRSPRDAIAAGVLLCPEDRKKEGIIPLGSVGENINISARPA 370

Query: 370 RGMFKPIPKKEAD-AIVDKYMKELNVRPADPDRPVKNLSGGNQQKVLIGRWLATHPELLI 428
                 + + + +    DK +K L V+     + +  LSGGNQQK ++GRWL+   ++L+
Sbjct: 371 HSALGCLLRGDWERGNADKQIKSLKVKTPAASQKIMYLSGGNQQKAILGRWLSMPMKVLL 430

Query: 429 LDEPTRGIDIGAKAEIQQVVLDLASQGMGVVFISSELEEVVRLSDDIEVLKDRHKIAEIE 488
           LDEPTRGIDIGAKAEI Q++ +LA+ G+ V+ +SS+L EV+ +SD I VL +     E+ 
Sbjct: 431 LDEPTRGIDIGAKAEIYQIIHNLAADGIAVIVVSSDLMEVMGISDRILVLCEGAMRGELS 490

Query: 489 ND 490
            D
Sbjct: 491 RD 492



 Score = 78.6 bits (192), Expect = 5e-19
 Identities = 62/241 (25%), Positives = 115/241 (47%), Gaps = 30/241 (12%)

Query: 18  PGVKALDGVDLTLYPGEVHALMGENGAGKSTMIKALTGVYKINAGSIMVDGKPQQFNGTL 77
           PG++  + V   ++ GE+  L G  GAG++ + + L+G+ + + GS+++ GK  +     
Sbjct: 277 PGLR--EPVSFQVHKGEILGLFGLVGAGRTELFRLLSGLERQSEGSLVLHGKELKLRSPR 334

Query: 78  DAQNAGIATVYQE---VNLCTNLSVGENV---------MLGHEKRGPFGIDWKKTHEAAK 125
           DA  AG+    ++     +    SVGEN+          LG   RG    DW++ +    
Sbjct: 335 DAIAAGVLLCPEDRKKEGIIPLGSVGENINISARPAHSALGCLLRG----DWERGN---- 386

Query: 126 KYLAQMGLESIDPHTPLSS-----ISIAMQQLVAIARAMVINAKVLILDEPTSSLDANEV 180
              A   ++S+   TP +S     +S   QQ   + R + +  KVL+LDEPT  +D    
Sbjct: 387 ---ADKQIKSLKVKTPAASQKIMYLSGGNQQKAILGRWLSMPMKVLLLDEPTRGIDIGAK 443

Query: 181 RDLFAIMRKVRDSGVAILFVSHFLDQIYEITDRLTILRNGQFIKEVMTKDTPRDELIGMM 240
            +++ I+  +   G+A++ VS  L ++  I+DR+ +L  G    E+         L+ + 
Sbjct: 444 AEIYQIIHNLAADGIAVIVVSSDLMEVMGISDRILVLCEGAMRGELSRDQANESNLLQLA 503

Query: 241 I 241
           +
Sbjct: 504 L 504



 Score = 65.9 bits (159), Expect = 3e-15
 Identities = 49/223 (21%), Positives = 104/223 (46%), Gaps = 10/223 (4%)

Query: 287 YKGEVVGFAGLLGSGRTELGRLLYGADKPDSGTYTLNGKKVNISDPYTALKNKIAYSTEN 346
           + G+V    G  G+G++ L ++L GA  P SG   +  + +       ++ + +A   + 
Sbjct: 39  HPGQVHALMGENGAGKSTLLKILGGAYIPSSGDLQIGEQTMAFKGTADSIASGVAVIHQE 98

Query: 347 RRDEGIIGDLTVRQNILIA-LQATRGMF-KPIPKKEADAIVDKYMKELNVRPADPDRPVK 404
                ++ ++TV +N+ +  L A  G+  + + +++A  ++     E+     DP   V 
Sbjct: 99  LH---LVPEMTVAENLFLGHLPARFGLVNRGVLRQQALTLLKGLADEI-----DPQEKVG 150

Query: 405 NLSGGNQQKVLIGRWLATHPELLILDEPTRGIDIGAKAEIQQVVLDLASQGMGVVFISSE 464
            LS G +Q V I + L+    ++  DEPT  +       +  ++  L  +G  V+++S  
Sbjct: 151 RLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRLMAIIARLRDEGKVVLYVSHR 210

Query: 465 LEEVVRLSDDIEVLKDRHKIAEIENDDTVSQATIVETIANTNV 507
           +EEV R+ + + V KD   +   EN   ++   +V  +   ++
Sbjct: 211 MEEVFRICNAVTVFKDGRYVRTFENMSELTHDQLVTCMVGRDI 253


Lambda     K      H
   0.316    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 605
Number of extensions: 28
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 513
Length of database: 514
Length adjustment: 35
Effective length of query: 478
Effective length of database: 479
Effective search space:   228962
Effective search space used:   228962
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory