Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate AO356_24685 AO356_24685 2-dehydro-3-deoxygluconokinase
Query= SwissProt::Q0JGZ6 (323 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_24685 Length = 326 Score = 128 bits (321), Expect = 2e-34 Identities = 99/318 (31%), Positives = 147/318 (46%), Gaps = 11/318 (3%) Query: 8 VVSFGEMLIDFVPTVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEFG 67 V+SFGE + V G LA F K GA +NVAI ++RLG A++ ++G D G Sbjct: 6 VLSFGETMAMLVADQRG-DLASVDQFHKRIAGADSNVAIGLSRLGFKVAWLSRVGADSLG 64 Query: 68 RMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADG-EREFMFYRNPSADMLLTHAELNV 126 R + L + G+D V D T F +L DG + + ++R SA L+ + Sbjct: 65 RFVTQTLENEGLDCRHVAVDPEHPTGFQFKSLTVDGSDPQVEYFRRSSAASHLSVGSIAP 124 Query: 127 ELIKRAAVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNLREALWPSREEARTKI 186 L+ V G + ++ R M + AG LS+DPNLR +LW S T I Sbjct: 125 ALLDARHVHATGIVPALSGTAREMSFELMSRMRAAGRSLSFDPNLRPSLWGSESTMITAI 184 Query: 187 LSIWDQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYYARDFRG 246 + A V E LTG D D L + +++++ LG G Y +G Sbjct: 185 NRLAALAHWVLPGLGEGRLLTGFDDPADIAAFYLDQGA-EIVVIKLGADGAYYRTALDQG 243 Query: 247 AVPSYKVQQ-VDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANACGAITATKKG 305 +P V Q VDT GAGD F L+ S+L + + + EA++ AN G+ +G Sbjct: 244 VIPGVPVAQVVDTVGAGDGFAVGLI-------SALLEGRAITEAVQRANWIGSRAVQSRG 296 Query: 306 AIPSLPTEVEVLKLMESA 323 + LPT +E+L E+A Sbjct: 297 DMEGLPTRIELLAEFETA 314 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 326 Length adjustment: 28 Effective length of query: 295 Effective length of database: 298 Effective search space: 87910 Effective search space used: 87910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory