Align ABC transporter permease (characterized, see rationale)
to candidate AO356_28575 AO356_28575 ABC transporter permease
Query= uniprot:A0A166QFV1 (320 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28575 Length = 320 Score = 588 bits (1516), Expect = e-173 Identities = 293/320 (91%), Positives = 307/320 (95%) Query: 1 MSVSSTHAPCDELLLTRETPVQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDAN 60 MSVS+T P DE L RETPVQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDA+ Sbjct: 1 MSVSTTLVPDDEYLPARETPVQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDAS 60 Query: 61 LADTGGGTFIGFGNYLFHNGSSWSGILVDPQWWNAVRNTLYFTVVSVGLEVVLGLLVALL 120 LADTG TF+G NYLFH+ + WSG+LVDPQWWNAVRNTL+FTVVSVGLE+VLGLLVALL Sbjct: 61 LADTGDATFVGLSNYLFHSSAGWSGLLVDPQWWNAVRNTLHFTVVSVGLEIVLGLLVALL 120 Query: 121 LNIKFTGRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLSLGLIDAPLAWTAD 180 LN++F+GRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLML LGLIDAPLAWTAD Sbjct: 121 LNVRFSGRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLGLGLIDAPLAWTAD 180 Query: 181 ADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPLKVFWRVTLPLLMP 240 ADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHP+KVFWRVTLPLLMP Sbjct: 181 ADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPVKVFWRVTLPLLMP 240 Query: 241 ALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLV 300 ALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLV Sbjct: 241 ALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLV 300 Query: 301 VAVIALLYLYLGRRQLEVRS 320 VAVIA++YLYLGRRQLEVRS Sbjct: 301 VAVIAMVYLYLGRRQLEVRS 320 Lambda K H 0.329 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 320 Length adjustment: 28 Effective length of query: 292 Effective length of database: 292 Effective search space: 85264 Effective search space used: 85264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory