Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate AO356_17605 AO356_17605 phosphoribosylglycinamide formyltransferase
Query= SwissProt::P33221 (392 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_17605 Length = 393 Score = 516 bits (1330), Expect = e-151 Identities = 264/392 (67%), Positives = 313/392 (79%), Gaps = 1/392 (0%) Query: 1 MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVIN 60 MT +GT L P ATRV+L GSGELGKEV IE QRLGVEVIAVDRYA+APAM VAHRSHVIN Sbjct: 1 MTRIGTPLSPTATRVLLCGSGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAHRSHVIN 60 Query: 61 MLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRL 120 MLDG ALR V+E EKPH+IVPEIEAIAT L++LE EG V+P ARA +LTMNREGIRRL Sbjct: 61 MLDGAALRAVIEAEKPHFIVPEIEAIATATLVELEAEGFTVIPTARAAQLTMNREGIRRL 120 Query: 121 AAEELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKY 180 AAEEL LPTS Y FAD+ +R+AV +G+PC+VKPVMSSSGKGQ+ +RSA+ + +AW Y Sbjct: 121 AAEELGLPTSPYFFADTVEDYRKAVETLGFPCVVKPVMSSSGKGQSLLRSADDVQKAWDY 180 Query: 181 AQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMS 240 AQ+GGRAG GRVI+EG + FD+EITLLTV V G FCAPVGHRQE GDY+ESWQPQ MS Sbjct: 181 AQEGGRAGKGRVIIEGFIDFDYEITLLTVRHVGGTTFCAPVGHRQEKGDYQESWQPQAMS 240 Query: 241 PLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEF 300 P+AL ++ +A+ V ALGG GLFGVELF+ GD+V FSEVSPRPHDTG+VTLISQDLS+F Sbjct: 241 PVALAESERVAKAVTEALGGRGLFGVELFIKGDQVWFSEVSPRPHDTGLVTLISQDLSQF 300 Query: 301 ALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVG-ADLQIRLFGKPEID 359 ALH RA LGLP+ IRQ+GP+AS+VIL + S F N+ A+ D +RLFGKPE++ Sbjct: 301 ALHARAILGLPIPLIRQFGPSASSVILVEGQSTQTAFANLGVALSEPDTALRLFGKPEVN 360 Query: 360 GSRRLGVALATAESVVDAIERAKHAAGQVKVQ 391 G RRLGVALA ES+ A +A A+ VK++ Sbjct: 361 GQRRLGVALARDESIEAARAKATRASQAVKIE 392 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 393 Length adjustment: 31 Effective length of query: 361 Effective length of database: 362 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory