Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate AO356_30035 AO356_30035 aminomethyltransferase
Query= curated2:Q7NFJ5 (359 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_30035 Length = 376 Score = 147 bits (372), Expect = 3e-40 Identities = 117/360 (32%), Positives = 176/360 (48%), Gaps = 30/360 (8%) Query: 9 LCAQHLQLGARLVPFGGWEMPLQY-STLTREHRAVRTAVGLFDISHMGKYTLSGPDVLAQ 67 L +H LG+ L + G Y S L H+A+RT GL D+S + K GP + Sbjct: 10 LAERHRALGSNLEDWNGMGTAWTYDSDLADHHQAIRTRAGLMDVSGLKKVHYVGPHAESL 69 Query: 68 IQRLVPSDLARLQPGQAQYTVLLNEQAGIIDDLIFYCRSPEHWVVIVNGATNDKDRRWLA 127 +Q D+A+L PG++ Y +L+E +DD I Y P ++V V+GA + + L Sbjct: 70 LQWATTRDIAKLYPGKSVYASMLDEDGKFVDDCIVYRTGPNAFMV-VHGAGSGHE--MLV 126 Query: 128 EHLQG----VHFDDLTGTHTLLALQGPAAVETLQPLVDIDLARLGRFEHAQVSLAGKPAF 183 QG V FDD H L+LQGP AV+ L V + +L F H Q L +P Sbjct: 127 RSSQGRQVAVLFDD--DLHD-LSLQGPLAVDFLAEHVP-GIRQLPYFHHLQTRLFDRPVM 182 Query: 184 LARTGYTGEDGFEIMSLEPEGIALWQSL----TAAGVPPCGLGARDTLRLEAAMHLYGQD 239 ++RTGYTGE G+EI + ALW ++ G+ PC A D LR+E+++ + D Sbjct: 183 ISRTGYTGERGYEIFCKAADAPALWDTILEQGAGLGIIPCAFTALDWLRVESSLMFFPYD 242 Query: 240 MDE---------STTPLEASLGWVIDWDKPDYFGREILLAQKAQGTER-RLVGLTVEGRQ 289 + T E L + + DK ++ G E + +G ER ++ G+ +EG + Sbjct: 243 NSQMYPFADQKAGDTLWEMGLDFTVSPDKREFRGAEEHF--RLRGQERFKITGVLLEGVR 300 Query: 290 IARHGYGLFDGEQQVGVVTSGTLTPTVDRPIALAYVGKPFAPIGSRLEVDIRGRRAMATV 349 A G L+ G QQVGV+T G + R +A+A + + G L+V RG + A V Sbjct: 301 AAEAGDTLWQGNQQVGVITCGMYSRLSKRSMAIARMSVACSSPGVALQV--RGSQESAAV 358 Lambda K H 0.321 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 376 Length adjustment: 30 Effective length of query: 329 Effective length of database: 346 Effective search space: 113834 Effective search space used: 113834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory