Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate AO356_30050 AO356_30050 aminomethyltransferase
Query= curated2:Q24TH3 (365 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_30050 Length = 780 Score = 194 bits (494), Expect = 5e-54 Identities = 128/371 (34%), Positives = 203/371 (54%), Gaps = 28/371 (7%) Query: 13 HRRAGA---KLIDFGGWEMPVQYAG--VIEEHKAVRSKAGLFDVSHMGEVELKGKDSLAF 67 H R A ID+ W +P++Y G IEE+ R + + D++ + + E+ G D+ A Sbjct: 407 HSRTSALTGSFIDYRNWWLPLRYDGYGAIEEYLGCRERVAVMDLTALRKFEIIGPDAEAL 466 Query: 68 LQYLLTNDVSRIQDNQIQYSPMCTSAGGVVDDLLVYRYSREHFLLVVNAANTDKDFA--W 125 LQY LT DV R+ Q+ YS MC GG++DD + R ++F + +D+A W Sbjct: 467 LQYCLTRDVRRLAVGQVVYSAMCHEHGGMLDDGTLLRLGPDNFRWICG-----EDYAGVW 521 Query: 126 MQAQAE--GFEISLENRSGDFAQLALQGPWAEKILQKL-----TSMDLAQINYYWFKHGE 178 ++ QA+ G ++ +++ S LA+QGP + ++L+++ T L + ++ F G Sbjct: 522 LREQAQKLGMKVWVKSASEQIHNLAVQGPMSRELLKQMVWTPPTQPSLETLGWFRFLVGR 581 Query: 179 VDGV---LCLISRTGYTGEDGFEIYLPPEHAPRMWERILEVGGSEGVQPIGLGARDTLRF 235 +DG +ISRTGYTGE G+E++ PE A ++W+RI ++G G+ P+GL A D LR Sbjct: 582 LDGYDGCPLMISRTGYTGELGYEVWCQPEDAEQVWDRIWQLGQPLGLVPLGLEALDMLRI 641 Query: 236 EARLPLYGNELGPDITPLEAGLGFFVKLEK--DNFIGKEALSAQKEKGVPRKLVGLEMIE 293 EA L G E P EAG+GF V L+ D+FIG++AL ++ KLVGL++ Sbjct: 642 EAGLIFAGYEFNDQTDPFEAGIGFSVPLKSKTDDFIGRDAL-LRRSAHPAHKLVGLQLSG 700 Query: 294 RGIARSHYPLQKEGKEIGFITSGSFSPTLNKNIALGLIPPEYAQIGETLDV-IIRG--KA 350 A P+ + ++G ITS SP L NIAL + A +G TL++ + G K Sbjct: 701 NEGAHHGDPVYRGRAQVGVITSACRSPLLASNIALCRVDVACADVGTTLEIGKVDGLQKR 760 Query: 351 VKARIIPSLFY 361 + A + ++FY Sbjct: 761 ISATVTAAIFY 771 Lambda K H 0.319 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 694 Number of extensions: 46 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 780 Length adjustment: 35 Effective length of query: 330 Effective length of database: 745 Effective search space: 245850 Effective search space used: 245850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory