Align hydroxyacylglutathione hydrolase (EC 3.1.2.6) (characterized)
to candidate AO356_24480 AO356_24480 hydroxyacylglutathione hydrolase
Query= BRENDA::Q8ZRM2 (251 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_24480 Length = 255 Score = 226 bits (577), Expect = 3e-64 Identities = 118/255 (46%), Positives = 161/255 (63%), Gaps = 5/255 (1%) Query: 1 MNLNSIPAFQDNYIWVLTNDEG-RCVIVDPGEAAPVLKAIAEHK-WMPEAIFLTHHHHDH 58 + ++++PAF DNYIW+L + RC +VDPG+AAPV + H W+ I +THHHHDH Sbjct: 2 IQISALPAFTDNYIWLLQDHSTQRCAVVDPGDAAPVQAWLDAHPGWVLSDILITHHHHDH 61 Query: 59 VGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYF 118 VGGV + L++ TVYGPA + D D + VLG F ++A PGHTLGH+ Y+ Sbjct: 62 VGGV-QALKNATNATVYGPASENIPARDQALHDNDQVSVLGWDFDVYAVPGHTLGHIAYY 120 Query: 119 SRPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSI 178 LFCGDTLF+ GCGRLFEGTP+QM+ SL ++ +LP+DTL+ C HEYTL+N+KFA ++ Sbjct: 121 HHGLLFCGDTLFAAGCGRLFEGTPAQMHHSLGRLAALPEDTLVYCTHEYTLSNLKFAAAV 180 Query: 179 LPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKET--ILQQ 236 P + I KV R + MTLP L E+ N FLRT + + + ++ + Q Sbjct: 181 EPGNPDIAARLEKVSRQRNEGIMTLPSTLALEKLTNPFLRTTETSVKQKADERSGQRNQT 240 Query: 237 PEARFAWLRSKKDTF 251 P FA LR+ KDTF Sbjct: 241 PSEVFAALRAWKDTF 255 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 255 Length adjustment: 24 Effective length of query: 227 Effective length of database: 231 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate AO356_24480 AO356_24480 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.15627.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-109 349.3 0.0 6e-109 349.2 0.0 1.0 1 lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 AO356_24480 hydroxyacylglutathio Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 AO356_24480 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 349.2 0.0 6e-109 6e-109 1 248 [] 4 255 .] 4 255 .] 0.98 Alignments for each domain: == domain 1 score: 349.2 bits; conditional E-value: 6e-109 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeek.glkleaillTHhHaDHvggva 61 i a+pa++dNyiwll+d+++ +++vvDpg+a+pv+++l+++ g+ l++il+THhH+DHvggv+ lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 4 ISALPAFTDNYIWLLQDHSTqRCAVVDPGDAAPVQAWLDAHpGWVLSDILITHHHHDHVGGVQ 66 5789**************999*****************99879******************** PP TIGR03413 62 ellekfpvkvvgpaeeripgltkevkegdevellelevevlevpGHtlgHiayyleeekvlFc 124 +l+++++++v+gpa+e+ip+ +++++++d+v++l+ +++v++vpGHtlgHiayy + ++lFc lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 67 ALKNATNATVYGPASENIPARDQALHDNDQVSVLGWDFDVYAVPGHTLGHIAYYHH--GLLFC 127 ********************************************************..***** PP TIGR03413 125 gDtLfsaGCGrlfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealker 187 gDtLf+aGCGrlfegt++qm++sl +laaLpe+t+vyc+HEYtlsNl+Fa+avep n+++++r lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 128 GDTLFAAGCGRLFEGTPAQMHHSLGRLAALPEDTLVYCTHEYTLSNLKFAAAVEPGNPDIAAR 190 *************************************************************** PP TIGR03413 188 lkevealrakgkptlPstlaeekatNpFLraeeaevkaalee....ekaeevevfaelRekkd 246 l++v+++r++g +tlPstla ek tNpFLr+ e++vk++++e +++++ evfa+lR++kd lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 191 LEKVSRQRNEGIMTLPSTLALEKLTNPFLRTTETSVKQKADErsgqRNQTPSEVFAALRAWKD 253 ****************************************9999988999************* PP TIGR03413 247 kf 248 +f lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_24480 254 TF 255 98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.38 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory