GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Pseudomonas fluorescens FW300-N2C3

Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate AO356_11880 AO356_11880 dihydrolipoamide dehydrogenase

Query= BRENDA::A0A0H2ZHZ0
         (467 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 AO356_11880
           dihydrolipoamide dehydrogenase
          Length = 466

 Score =  711 bits (1836), Expect = 0.0
 Identities = 346/465 (74%), Positives = 402/465 (86%)

Query: 2   MESYDVIVIGAGPGGYNAAIRAGQLGLKVACVEGRETLGGTCLNVGCMPSKALLHASELY 61
           M +YDV+++G GPGGYNAAIRAGQLGLK ACVEGR TLGGTCLNVGCMPSKALLHASELY
Sbjct: 1   MSNYDVVILGGGPGGYNAAIRAGQLGLKAACVEGRATLGGTCLNVGCMPSKALLHASELY 60

Query: 62  AAASGGEFARLGIRVSPELDLAQMMKQKDESVAALTRGVEFLFRKHKVQWIKGWARLQGE 121
            AA+G EFA LGI VSP L+LAQMMKQKDESV  LT+G+EFLFRK+KV WIKGW  + G 
Sbjct: 61  EAATGTEFANLGIEVSPTLNLAQMMKQKDESVTGLTKGIEFLFRKNKVDWIKGWGHIDGP 120

Query: 122 GRVGVALADGGHAQLEARDIVIATGSEPAPLPGVPVDNQRILDSTGALELAEVPRHLVVI 181
           G+V V   DG   +L A+DIVIATGSEP PLPGV +DNQRILDSTGAL L+EVPRHLVVI
Sbjct: 121 GKVTVTGDDGSKTELTAKDIVIATGSEPMPLPGVTIDNQRILDSTGALSLSEVPRHLVVI 180

Query: 182 GAGVIGLELGSVWRRLGAQVTVLEYLERICPGLDGETARTLQRALTRQGMRFRLGTRVVA 241
           GAGVIGLELGSVWRRLGAQVTV+EYL+RICPG+DGE  +TLQRAL +QG++F+L ++V  
Sbjct: 181 GAGVIGLELGSVWRRLGAQVTVVEYLDRICPGVDGEAGKTLQRALAKQGIQFKLSSKVTG 240

Query: 242 ARSGEQGVELDLQPAAGGATESLQADYVLVAIGRRPYTEGLGLETVGLASDRRGMLENQG 301
           A +   GV+L ++PAAGG  + L ADYVLVAIGRRPYT+GLGLE VGL++D+RGML NQ 
Sbjct: 241 ATTSASGVQLQIEPAAGGEAQILDADYVLVAIGRRPYTQGLGLENVGLSTDKRGMLANQH 300

Query: 302 QRSAAPGVWVIGDVTSGPMLAHKAEEEAIVCIERIAGHAAEMNAEVIPSVIYTQPEVASV 361
            R+ APGVWVIGDVT+GPMLAHKAE+EA+ CIE+IAG AAE+N  +IPSVIYT+PE+ASV
Sbjct: 301 HRTEAPGVWVIGDVTAGPMLAHKAEDEAMACIEQIAGKAAEVNYALIPSVIYTRPELASV 360

Query: 362 GLGEEQLQAARREYKVGRFPFSANSRAKINHESEGFIKILSDARSDQVLGVHMIGPGVSE 421
           G  EEQL+A  R YKVG+FPF+ANSRAKINHE+EGF K+L+D R+D++LGVH++GP VSE
Sbjct: 361 GQTEEQLKAEGRAYKVGKFPFTANSRAKINHETEGFAKVLADERTDEILGVHLVGPSVSE 420

Query: 422 MIGEACVAMEFSASAEDLALTCHPHPTRSEALRQAAMDVHGRAMQ 466
           MIGE CVAMEFSASAED+ALTCHPHPTRSEALRQAAM+V G A Q
Sbjct: 421 MIGEYCVAMEFSASAEDIALTCHPHPTRSEALRQAAMNVEGMATQ 465


Lambda     K      H
   0.318    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 793
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 467
Length of database: 466
Length adjustment: 33
Effective length of query: 434
Effective length of database: 433
Effective search space:   187922
Effective search space used:   187922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate AO356_11880 AO356_11880 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.4067.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   1.9e-167  543.5   1.1   2.1e-167  543.4   1.1    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880  AO356_11880 dihydrolipoamide deh


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880  AO356_11880 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  543.4   1.1  2.1e-167  2.1e-167       1     460 [.       3     465 ..       3     466 .] 0.96

  Alignments for each domain:
  == domain 1  score: 543.4 bits;  conditional E-value: 2.1e-167
                                       TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalvek.eklGGtClnvGCiPtKalLksaevveelke 62 
                                                     +ydvv++GgGpgGY aAira+qlglk a+ve   +lGGtClnvGC+P+KalL+++e++e ++ 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880   3 NYDVVILGGGPGGYNAAIRAGQLGLKAACVEGrATLGGTCLNVGCMPSKALLHASELYEAATG 65 
                                                     69*****************************8799************************9875 PP

                                       TIGR01350  63 ..akelgievenvkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkkevevkk 123
                                                       +++lgiev + +l+l++++++k++ v+ l++G+++L++knkv+ ikG +++ ++++v+v++
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880  66 teFANLGIEV-SPTLNLAQMMKQKDESVTGLTKGIEFLFRKNKVDWIKGWGHIDGPGKVTVTG 127
                                                     5699****88.789************************************************9 PP

                                       TIGR01350 124 ekke.kkleakniiiAtGseprelplkleedekvvitseealelkevpeslvivGgGviGvEf 185
                                                     ++++ ++l+ak+i+iAtGsep  lp+ +  d++++++s++al+l+evp++lv++G+GviG+E+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 128 DDGSkTELTAKDIVIATGSEPMPLPG-VTIDNQRILDSTGALSLSEVPRHLVVIGAGVIGLEL 189
                                                     998867899*****************.9999999***************************** PP

                                       TIGR01350 186 asifaklGvkvtvielldrilpaldaevskvlkkklkkkgvkiltnakvtevekeedevv..v 246
                                                     +s++++lG++vtv+e+ldri+p +d e  k+l+++l k+g++++ ++kvt  ++++  v+  +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 190 GSVWRRLGAQVTVVEYLDRICPGVDGEAGKTLQRALAKQGIQFKLSSKVTGATTSASGVQlqI 252
                                                     **************************************************7777777777335 PP

                                       TIGR01350 247 eakkk.evetleaekvLvavGrkpnleelgleklgveldergaikvdeelrtnvpgiyaiGDv 308
                                                     e   + e++ l+a++vLva+Gr+p +++lgle++g+++d+rg +  +++ rt++pg+++iGDv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 253 EPAAGgEAQILDADYVLVAIGRRPYTQGLGLENVGLSTDKRG-MLANQHHRTEAPGVWVIGDV 314
                                                     5555569*********************************99.567***************** PP

                                       TIGR01350 309 igklmLAhvAskegvvaaekiagkekseidykavPsviytePevasvGlteeqakeegievkv 371
                                                     ++++mLAh+A++e++ ++e+iagk++ e++y ++Psviyt+Pe+asvG teeq+k+eg ++kv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 315 TAGPMLAHKAEDEAMACIEQIAGKAA-EVNYALIPSVIYTRPELASVGQTEEQLKAEGRAYKV 376
                                                     ***********************887.9*********************************** PP

                                       TIGR01350 372 gkfpfaangkalaleetdGfvkvivdkktgeilGahivgaeaseliselalaveleltveela 434
                                                     gkfpf+an++a + +et+Gf+kv++d+ t+eilG+h+vg+++se+i e  +a+e+ +++e++a
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 377 GKFPFTANSRAKINHETEGFAKVLADERTDEILGVHLVGPSVSEMIGEYCVAMEFSASAEDIA 439
                                                     *************************************************************** PP

                                       TIGR01350 435 ktihpHPtlsEaikeaalaalgkaih 460
                                                      t+hpHPt sEa+ +aa ++ g+a +
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_11880 440 LTCHPHPTRSEALRQAAMNVEGMATQ 465
                                                     ******************99988765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (466 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.55
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory