GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Pseudomonas fluorescens FW300-N2C3

Align dihydrolipoyl dehydrogenase; EC 1.8.1.4 (characterized)
to candidate AO356_19705 AO356_19705 dihydrolipoamide dehydrogenase

Query= CharProtDB::CH_015561
         (478 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 AO356_19705
           dihydrolipoamide dehydrogenase
          Length = 478

 Score =  875 bits (2262), Expect = 0.0
 Identities = 450/478 (94%), Positives = 460/478 (96%)

Query: 1   MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKAL 60
           MTQKFDVVVIGAGPGGYVAAIKAAQLGL TACIEKYTD EGK ALGGTCLNVGCIPSKAL
Sbjct: 1   MTQKFDVVVIGAGPGGYVAAIKAAQLGLTTACIEKYTDGEGKQALGGTCLNVGCIPSKAL 60

Query: 61  LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQG 120
           LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLT GVATLFKANGVTSIQG
Sbjct: 61  LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTSGVATLFKANGVTSIQG 120

Query: 121 HGKLLAGKKVEVTKADGTTEVIEAENVILASGSRPIDIPPAPVDQNVIVDSTGALEFQAV 180
           HGKLL GKKVEVTK DG+ EVIEAENVILA GSRPIDIPPAPVDQNVIVDSTGALEFQ+V
Sbjct: 121 HGKLLLGKKVEVTKPDGSVEVIEAENVILAPGSRPIDIPPAPVDQNVIVDSTGALEFQSV 180

Query: 181 PKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIK 240
           PKRLGVIGAGVIGLELGSVW+RLGA+VTVLEALDTFLMAAD AVSKEA KTLTKQGLDIK
Sbjct: 181 PKRLGVIGAGVIGLELGSVWSRLGAQVTVLEALDTFLMAADAAVSKEALKTLTKQGLDIK 240

Query: 241 LGARVTGSKVNGNEVEVTYTNAEGEQKITFDKLIVAVGRRPVTTDLLAADSGVTIDERGY 300
           LGARVTGSKVNG EV V YT+A GEQ ITFDKLIVAVGRRPVTTDLLAADSGV +DERG+
Sbjct: 241 LGARVTGSKVNGEEVVVNYTDANGEQTITFDKLIVAVGRRPVTTDLLAADSGVDLDERGF 300

Query: 301 IFVDDYCATSVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH 360
           I VDD+CAT+VPGV+AIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH
Sbjct: 301 IKVDDFCATTVPGVFAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH 360

Query: 361 PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI 420
           PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI
Sbjct: 361 PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI 420

Query: 421 GPSAAELVQQGAIAMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR 478
           GPSAAELVQQGAI MEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR
Sbjct: 421 GPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR 478


Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 915
Number of extensions: 17
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 478
Length of database: 478
Length adjustment: 34
Effective length of query: 444
Effective length of database: 444
Effective search space:   197136
Effective search space used:   197136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

Align candidate AO356_19705 AO356_19705 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.4386.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   1.1e-163  531.1  11.3   1.3e-163  530.9  11.3    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705  AO356_19705 dihydrolipoamide deh


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705  AO356_19705 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  530.9  11.3  1.3e-163  1.3e-163       1     461 []       4     472 ..       4     472 .. 0.97

  Alignments for each domain:
  == domain 1  score: 530.9 bits;  conditional E-value: 1.3e-163
                                       TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalve.......keklGGtClnvGCiPtKalLksaev 56 
                                                     ++dvvviG+GpgGYvaAi+aaqlgl +a++e       k+ lGGtClnvGCiP+KalL s+  
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705   4 KFDVVVIGAGPGGYVAAIKAAQLGLTTACIEkytdgegKQALGGTCLNVGCIPSKALLDSSWK 66 
                                                     59*****************************44444334579********************* PP

                                       TIGR01350  57 veelke.akelgievenvkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkke 118
                                                     ++e+ke ++ +gi++ +vk+d+++++ rk  +vk+l++Gv++L+k n+v++i+G++kll  k+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705  67 YKEAKEsFNVHGISTGEVKMDVAAMVGRKAGIVKNLTSGVATLFKANGVTSIQGHGKLLLGKK 129
                                                     ******9******************************************************** PP

                                       TIGR01350 119 vevkkekke.kkleakniiiAtGseprelplkleedekvvitseealelkevpeslvivGgGv 180
                                                     vev+k +++ +++ea+n+i+A Gs+p+ +p    +d++v+++s++ale+++vp++l ++G+Gv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 130 VEVTKPDGSvEVIEAENVILAPGSRPIDIPP-APVDQNVIVDSTGALEFQSVPKRLGVIGAGV 191
                                                     *****998889*******************9.8999999************************ PP

                                       TIGR01350 181 iGvEfasifaklGvkvtvielldrilpaldaevskvlkkklkkkgvkiltnakvtevekeede 243
                                                     iG+E++s++++lG++vtv+e+ld+ l a da vsk++ k+l+k+g++i+ +a+vt  + + +e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 192 IGLELGSVWSRLGAQVTVLEALDTFLMAADAAVSKEALKTLTKQGLDIKLGARVTGSKVNGEE 254
                                                     *******************************************************98888888 PP

                                       TIGR01350 244 vvveakkk.evetleaekvLvavGrkpnleelgleklgveldergaikvdeelrtnvpgiyai 305
                                                     vvv+  +   ++t++ +k++vavGr+p +++l  +  gv+lderg+ikvd+ + t+vpg++ai
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 255 VVVNYTDAnGEQTITFDKLIVAVGRRPVTTDLLAADSGVDLDERGFIKVDDFCATTVPGVFAI 317
                                                     886666655679*************************************************** PP

                                       TIGR01350 306 GDvigklmLAhvAskegvvaaekiagkekseidykavPsviytePevasvGlteeqakeegie 368
                                                     GDv++++mLAh+As+eg++++e+i g+++ +++y+++Psviyt+Pe+a vG+te+ +k+eg+e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 318 GDVVRGMMLAHKASEEGIMVVERIKGHKA-QMNYDLIPSVIYTHPEIAWVGKTEQALKAEGVE 379
                                                     **************************665.9******************************** PP

                                       TIGR01350 369 vkvgkfpfaangkalaleetdGfvkvivdkktgeilGahivgaeaseliselalaveleltve 431
                                                     v+vg fpfaa+g+a+a+++t Gfvkvi+d kt+++lG+h++g++a+el+++ a+ +e+++++e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 380 VNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAE 442
                                                     *************************************************************** PP

                                       TIGR01350 432 elaktihpHPtlsEaikeaalaalgkaihv 461
                                                     +l ++++ HPtlsEa++eaala++g aihv
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_19705 443 DLGMMVFSHPTLSEALHEAALAVNGGAIHV 472
                                                     ****************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (478 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.42
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory